KEGG   Escherichia coli IHE3034: ECOK1_1472Help
Entry
ECOK1_1472        CDS       T01997                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eih  Escherichia coli IHE3034
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eih00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ECOK1_1472 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECOK1_1472 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECOK1_1472 (trpA)
Enzymes [BR:eih01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ECOK1_1472 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1481599..1482405)
Genome map
AA seq 268 aa AA seqDB search
MERYESLFTQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPAQCFEVLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAECEK
VGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKI
IEQHINEPEKMLAALKAFVQPMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaatctctgtttacccagttgaaggagcgcaaagaaggcgcattcgtt
cctttcgtcaccctcggtgatccgggcattgagcagtcgttgaaaattatcgatacgcta
attgaagccggtgctgacgcgctggagttaggcatccccttctccgacccactggcggat
ggcccgacgattcaaaacgccacactgcgtgcttttgcggcgggagtaaccccggcgcag
tgctttgaggtgctggcactcattcgccagaagcacccgaccattcccatcggccttttg
atgtatgccaacctggtgtttaacaaaggcattgatgagttttatgccgagtgcgagaaa
gtcggcgtcgattcggtgctggttgccgatgtgcccgtggaagagtccgcgcccttccgc
caggccgcgttgcgtcataatgtcgcacctatctttatttgcccgcctaatgccgacgat
gatttgctgcgccagatagcctcttacggtcgtggttacacctatttgctgtcgcgagcg
ggcgtgaccggcgcagaaaaccgcgccgcgttacccctcaatcatctggttgcgaagctg
aaagagtacaacgctgcgcctccattgcagggatttggtatttccgccccggatcaggta
aaagcagcgattgatgcaggagctgcgggcgcgatttctggttcggccatcgttaaaatc
atcgagcaacatattaatgagccagagaaaatgctggcggcactgaaagcttttgtacaa
ccgatgaaagcggcgacgcgcagttaa

DBGET integrated database retrieval system