KEGG   Escherichia coli IHE3034: ECOK1_1473Help
Entry
ECOK1_1473        CDS       T01997                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
eih  Escherichia coli IHE3034
Pathway
eih00260  Glycine, serine and threonine metabolism
eih00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eih01100  Metabolic pathways
eih01110  Biosynthesis of secondary metabolites
eih01130  Biosynthesis of antibiotics
eih01230  Biosynthesis of amino acids
Module
eih_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eih00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECOK1_1473 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECOK1_1473 (trpB)
Enzymes [BR:eih01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ECOK1_1473 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADE88553
Structure
PDB: 

Jmol
Position
complement(1482405..1483598)
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALT
KCQNITAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTKIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGM
FADFINETDVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSI
SAGLDFPSVGPQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattacttaacccctattttggtgagtttggcggcatgtacgtgccacaaatc
ctgatgcctgctctgcgccagctggaagaagcttttgtcagcgcgcaaaaagatcctgaa
tttcaggctcagttcaacgacctgctgaaaaactatgccgggcgtccaaccgcgctgacc
aaatgccagaacattacagccgggacgaacaccacgctgtatctgaagcgcgaagatttg
ctgcacggcggcgcgcataaaactaaccaggtgctcggtcaggctttactggcgaagcgg
atgggtaaaactaaaattattgccgaaaccggtgccggtcagcatggcgtggcgtcggcc
cttgccagcgccctgctcggcctgaaatgccgtatttatatgggtgccaaagacgttgaa
cgccagtcgcctaacgttttccggatgcgcttaatgggtgcggaagtgatcccggtgcat
agcggttccgcgaccctgaaagatgcctgtaatgaggcgctacgcgactggtccggcagt
tatgaaaccgcgcactatatgctgggtaccgcagctggcccgcatccttacccgaccatt
gtgcgtgagtttcagcggatgattggcgaagaaacgaaagcgcagattctggaaagagaa
ggtcgcctgccggatgccgttatcgcctgtgttggcggtggttcgaatgccatcggtatg
tttgcagatttcatcaacgaaaccgacgtcggcctgattggtgtggagcctggcggccac
ggtatcgaaactggcgagcacggcgcaccgttaaaacatggtcgcgtgggcatctatttc
ggtatgaaagcgccgatgatgcaaaccgaagacgggcaaattgaagagtcttactccatt
tctgccgggctggatttcccgtccgtcggcccgcaacatgcgtatctcaacagcactgga
cgcgctgattacgtgtctattaccgacgatgaagccctggaagcctttaaaacgctttgc
ctgcatgaagggatcatcccggcgctggaatcctcccacgccctggcccatgcgctgaaa
atgatgcgcgaaaatcccgaaaaagagcagctactggtggttaacctttccggtcgcggc
gataaagacatcttcaccgttcacgatattttgaaagcacgaggggaaatctga

DBGET integrated database retrieval system