KEGG   Escherichia coli IHE3034: ECOK1_1474Help
Entry
ECOK1_1474        CDS       T01997                                 

Gene name
trpC
Definition
(GenBank) tryptophan biosynthesis protein trpCF
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
eih  Escherichia coli IHE3034
Pathway
eih00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eih01100  Metabolic pathways
eih01110  Biosynthesis of secondary metabolites
eih01130  Biosynthesis of antibiotics
eih01230  Biosynthesis of amino acids
Module
eih_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eih00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECOK1_1474 (trpC)
Enzymes [BR:eih01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ECOK1_1474 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     ECOK1_1474 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADE90460
Structure
PDB: 

Jmol
Position
complement(1483610..1484968)
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVEARKQQQPLASFQNEIQPSTRHFYDALQGARTAFILECKKASPS
KGVIRDDFDPARIATVYRNYASAISVLTDEKYFQGSFDFLPIVSQIAPQPILCKDFIIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLAAVAHSLEMGVLTEVSNEEELERAIALGAKV
VGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVRELSHFANGFLIGSALM
AHDDLNAAVRRVLLGENKVCGLTRPQDARAAYDAGAIYGGLIFVTTSPRCVSVEQAQEVM
AAAPLQYVGVFRNHDIADVVDKAKVLSLAAVQLHGNEDQLYIDTLREALPAHVAIWKALS
VGETLPARDFQHIDKYVFDNGQGGSGQRFDWSLLNGQSLGNVLLAGGLGADNCVEAAQTG
CAGLDFNSAVESQPGIKDARLLASVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaagcccgcaaa
cagcagcaaccgctggccagttttcagaatgagattcagccgagcacgcgacatttttat
gatgcgctacagggtgcacgcacggcgtttattctggagtgcaaaaaagcgtcgccgtca
aaaggcgtgatccgtgatgatttcgatccggcacgcattgcaaccgtttacagaaattat
gcttcggcaatttcggtgctgactgatgagaaatattttcagggaagctttgatttcctc
cccatcgtcagccaaatcgccccacagccgattttatgtaaagactttattatcgaccct
taccagatctatctggcgcgctattaccaggccgatgcctgcttattaatgctttcagta
ctggatgatgaacaatatcgccagcttgccgccgtcgcccacagtctggagatgggtgtg
ctgaccgaagtcagtaatgaagaggaactggagcgcgccattgcattgggggcaaaggtc
gttggcatcaacaaccgcgatctgcgcgatttgtcgattgatctcaaccgtacccgcgag
cttgcgccgaaactggggcacaatgtgacggtaatcagcgaatccggcatcaatacttac
gctcaggtgcgcgagttaagccacttcgctaacggttttctgattggttcggcgttgatg
gcccatgacgatttgaacgccgccgtgcgccgggtgttgctgggtgagaataaagtgtgt
ggcctgactcgcccacaagatgccagagccgcttatgacgctggtgctatatacggtgga
ttaatatttgttacaacgtcaccgcgttgcgtcagcgttgaacaggcgcaggaagtgatg
gctgcggcaccgttgcagtatgttggcgtgttccgcaatcacgatattgccgatgtggtg
gacaaagctaaggtgttatcgctggcggcagtgcaactgcatggtaatgaagatcagctg
tatatcgacactctgcgtgaggctctgccagcacacgtcgccatctggaaggctttaagt
gtcggtgaaactcttcccgcgcgcgattttcagcacatcgataaatatgtattcgacaac
ggtcagggcgggagcggacaacgtttcgactggtcactattaaatggtcaatcgcttggc
aacgttctgctggcggggggcttaggcgcagataactgcgtggaagcggcacaaaccggc
tgcgccgggcttgattttaattctgctgtagagtcgcaaccgggtatcaaagacgcacgt
cttttggcctcggttttccagacgctgcgcgcatattaa

DBGET integrated database retrieval system