KEGG   Escherichia coli IHE3034: ECOK1_1635Help
Entry
ECOK1_1635        CDS       T01997                                 

Definition
oxidoreductase, zinc-binding dehydrogenase family
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
eih  Escherichia coli IHE3034
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eih00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ECOK1_1635
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECOK1_1635
  Lipid metabolism
   00071 Fatty acid degradation
    ECOK1_1635
  Amino acid metabolism
   00350 Tyrosine metabolism
    ECOK1_1635
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ECOK1_1635
   00626 Naphthalene degradation
    ECOK1_1635
Enzymes [BR:eih01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ECOK1_1635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1663979..1664989)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMAEE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAARIVQEKAGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagttgttacgaaggatcatcatgttgacgttacggataaaacactgcgc
tcactgaaacatggcgaagccctgctgaaaatggagtgttgtggtgtatgtcataccgat
cttcatgttaagaatggcgattttggtgacaaaaccggcgtgattctgggacacgaaggt
attggtgtggtggcagaagttggccctggtgttacttcattaaaaccaggcgatcgtgcc
agcgtggcgtggttctatgaaggatgcggtcattgcgaatactgtaacagtggtaacgaa
acgctctgccgttcagttaaaaatgccggatacagcgttgatggcgggatggcggaagag
tgcatcgtggtcgccgattacgcggtaaaagtgccagatggtctggactcggcggcggcc
agcagcattacctgtgcgggggtcactacctacaaagccgttaagctgtcaaaaattcgt
ccaggacagtggattgctatctacggtcttggcggtctgggtaacctcgccctgcaatac
gcgaagaatgtctttaacgccaaagtgatcgccattgatgtcaatgatgaacagttaaaa
ctggcaaccgaaatgggtgcagatttagcgattaactcacgcaccgaagacgccgccaga
attgtgcaggagaaagccggtggcgctcacgcagcggtggtgacagcggtagctaaagct
gcgtttaactcggcggtggatgctgtccgtgcaggtggtcgtgtcgtggctgtcggtctg
ccgccggagtctatgagcctggacatcccacggctggtgctggatggtattgaagtggtc
ggttcgctggtcggcacgcgtcaggatctaaccgaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcgccctgcgtccgttagcggacatcaacaccatatttaccgag
atggaagaaggcaaaatccgtggccgtatggtgattgatttccgtcgctaa

DBGET integrated database retrieval system