KEGG   Escherichia coli IHE3034: ECOK1_1681Help
Entry
ECOK1_1681        CDS       T01997                                 

Definition
putative 6-phospho-beta-glucosidase BglA
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eih  Escherichia coli IHE3034
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eih00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1713527..1714966)
Genome map
AA seq 479 aa AA seqDB search
MSGFKEDFLWGGAVAAHQLEGGWNEGGKGISIADVMTAGAHGVPREVTEGVIDGLNYPNH
EAIDFYHRYKTDIQLFAGMGFKCFRTSIAWTRIFPQGDEQEPNEEGLQFYDDLFDECLKQ
GMEPVVTLSHFEMPYHLVTKYGGWRNRKLIDFFIHFASTVFTRYKAKVKYWMTFNEINNQ
VNFSESLCPFTNSGILYSPEEDLNEREQIMYQAVHYELVASALAVQTGKLINPEFNIGCM
IAMCPIYPLTCAPNDMMMATKAMHRRYWFTDVHARGYYPQHMLNYFARKGFNLDITPDDN
AILARGCVDFIGFSYYMSFTTQFSPDNPQLDYVEPRDLVSNPYIDTSEWGWQIDPAGLRY
SLNWFWDHFQLPLFIVENGFGAVDQRQADGTVNDHYRIDYFSSHIREMKKAVVEDGVDLI
GYTPWGCIDLVSAGTGEMKKRYGMIYVDKDNEGKGTLERIRKASFYWYRDLIANNGENI
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggatttaaagaagattttttatggggcggtgcggtagccgcacatcaattggaa
ggtggctggaatgaaggaggaaaaggcatcagtatcgctgatgtaatgactgctggcgct
cacggggtgccgcgtgaagtgacagaaggcgttatcgacggacttaattatcccaatcat
gaagcaattgatttttatcatcgctataaaacagatattcagttatttgccgggatggga
ttcaaatgctttcgaacttccattgcctggacacgaatctttccgcaaggtgacgaacag
gagccgaatgaagagggtttacaattttatgatgatctcttcgatgaatgcctgaagcag
ggaatggaacctgtggtgacgctttcgcattttgagatgccttatcatctggtgacaaaa
tatggtggctggcgaaaccgtaaactgatcgacttttttatccacttcgcatcaacggtc
ttcacgcgctataaagcaaaagtaaagtactggatgacgtttaacgaaatcaataatcag
gtgaatttcagcgaaagcctgtgtccatttactaattccggtatcttgtattcgccagag
gaagatctcaatgagcgcgaacaaataatgtaccaggcggtacattatgagttagttgcc
agtgccctggcggtacagactggaaaactgatcaatcctgaatttaatatcggctgtatg
attgctatgtgccccatctatcctctgacgtgtgcacccaacgatatgatgatggccacg
aaagcgatgcatcgtcgttactggtttactgatgttcatgctcgtggatattatccgcaa
catatgctgaattactttgcaaggaaaggattcaacctcgatatcacaccagatgataac
gcgattcttgccagaggttgtgtcgactttatcggctttagctactacatgtcttttacg
acgcaattttcgccagataatccgcaactggattatgttgaaccacgagatttggtcagc
aacccttatatcgatacatccgaatggggatggcaaattgatccggcagggctacgttat
tcactcaactggttctgggatcatttccagttgccgctgtttattgtcgaaaatggattt
ggtgcggttgaccagagacaagctgacggcacggtgaacgatcactatcgcattgattac
ttttcctcccatattcgggaaatgaaaaaagccgtagttgaagatggtgttgacttaatt
ggctacaccccgtggggttgcattgacctggtttctgccggaacaggagaaatgaaaaaa
cgctacggaatgatttatgtcgataaagacaacgaagggaagggaacgctggaacggata
cgtaaagcatcgttttactggtatcgggatctcatcgccaacaatggcgaaaatatatga

DBGET integrated database retrieval system