KEGG   Escherichia coli IHE3034: ECOK1_2036Help
Entry
ECOK1_2036        CDS       T01997                                 

Gene name
dcyD
Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
eih  Escherichia coli IHE3034
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:eih00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ECOK1_2036 (dcyD)
Enzymes [BR:eih01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     ECOK1_2036 (dcyD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2058486..2059472)
Genome map
AA seq 328 aa AA seqDB search
MPLHNLTRFPRLEFIGAPTPLEYLPRFSDYLGREIFIKRDDVTPMAMGGNKLRKLEFLAA
DALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLD
LFNTQIEMCDALTDPNTQLEELATRVEAQGFRPYVIPVGGSNALGALGYVESALEIAQQC
EGAVNISSVVVASGSAGTHAGLAVGLEHLMPESELIGVTVSRSVADQLPKVVNLQQAIAK
ELELTASAEILLWDDYFAPGYGVPNDEGMEAVKLLARLEGILLDPVYTGKAMAGLIDGIS
QKRFKDEGPILFIHTGGAPALFAYHPHV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccactgcataatttaacccgttttccacggctggagtttatcggcgcgccaacgccg
ctcgaatatctgccgcgcttttctgattatcttggacgggaaattttcatcaaacgggat
gacgtcactcccatggcaatgggcggcaataaattacgtaagctggaatttctcgcggca
gatgctctgcgtgaaggtgccgatacgctgattactgccggggcgatccagtctaaccat
gtgcgccagactgccgcagtcgctgcgaaactcggtctgcattgcgtggcgctgctggaa
aatcctattggtacaaccgcggaaaactatttaaccaacggcaatcgtttgttgctggat
ctgttcaatacccagattgaaatgtgcgacgcactgaccgatcccaatacccaactggaa
gagctggcgacgcgagtcgaagcacaaggctttcgcccgtatgtcattccggttggcggt
tctaatgctttgggcgcgctgggttatgtggagagtgcgctggaaatcgcgcaacagtgt
gaaggggcagttaatatttcgtcggtggtggtcgcatcgggcagtgccggaactcacgcc
ggactggctgttgggctggaacacctgatgcctgaaagcgaactgattggcgtgactgtg
tcgcgttctgttgccgatcaattgccgaaagtggttaacctccaacaggcgattgcgaaa
gaactggagctgaccgcatcagcggaaattttactctgggatgactattttgcacctggc
tacggcgtgccgaacgacgaaggcatggaagcagtgaaattgctggcgcggctggaaggc
attctgcttgatcctgtgtataccggaaaagcgatggcggggctgattgacggtatcagt
cagaaacgcttcaaagatgaagggccgattctgtttattcataccggcggtgcgcctgcg
ctgttcgcctatcatccccacgtttag

DBGET integrated database retrieval system