KEGG   Escherichia coli IHE3034: ECOK1_2270Help
Entry
ECOK1_2270        CDS       T01997                                 

Gene name
galF
Definition
regulatory protein GalF
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eih  Escherichia coli IHE3034
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eih00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECOK1_2270 (galF)
   00052 Galactose metabolism
    ECOK1_2270 (galF)
   00500 Starch and sucrose metabolism
    ECOK1_2270 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    ECOK1_2270 (galF)
Enzymes [BR:eih01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ECOK1_2270 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2328671..2329564)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQAVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttattcctgtagcgggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatc
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcgtccaag
aacgcggtcgaaaaccacttcgacacctcttatgaattagaatctctccttgaacagcgc
gtgaagcgtcaactgctggcggaagtacagtccatttgcccgccgggcgtgacaattatg
aacgtgcgtcagggcgaacctttaggtttgggccactccattttatgtgcacgacctgcc
attggtgacaatccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagcgcc
gacccgctgcgctacaaccttgctgccatgattgcgcgctttaacgaaactggccgcagc
caggttctggcaaaacgcatgccgggcgatctctctgaatactccgtcatccagactaaa
gaaccgcttgatcgcgaaggtaaagtcagccgcattgttgaatttatcgaaaaaccggat
cagccgcagaccctggactcagacatcatggctgtagggcgttatgtgctttctgccgat
atttggcctgaactggagcgtactcaacctggagcatggggacgtattcagttgactgat
gccattgctgagttggcaaaaaaacaagcagttgacgcaatgctgatgactggggacagt
tacgactgcggaaagaaaatgggttatatgcaagcgtttgtgaagtatgggctgcgtaac
ctaaaagaaggggcgaagttccgtaaagggattgagaagctgttaagcgaataa

DBGET integrated database retrieval system