KEGG   Escherichia coli IHE3034: ECOK1_3088Help
Entry
ECOK1_3088        CDS       T01997                                 

Gene name
ascB
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eih  Escherichia coli IHE3034
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eih00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3153126..3154550
Genome map
AA seq 474 aa AA seqDB search
MSVFPQGFLWGGALAANQSEGAYREGGKGLTTVDMIPHGEHRMAVKLGLEKRFQLRDDEF
YPSHEATDFYHRYKEDIALMAEMGFKVFRTSIAWSRLFPQGDELTPNQQGIAFYRAVFEE
CKKYGIEPLVTLCHFDVPMHLVTEYGSWRNRKLVELFSRYARTCFEAFDGLVKYWLTFNE
INIMLHSPFSGAGLVFEEGENQDQVKYQAAHHQLVASALATKIAHEVNPQNQVGCMLAGG
NFYPYSCKPEDVWAALEKDRENLFFIDVQARGAYPAYSARVFREKGVTIDKAPSDDEILK
NTVDFVSFSYYASRCASAEMNANNCSAANVVKSLRNPYLQVSDWGWGIDPLGLRITMNMM
YDRYQKPLFLVENGLGAKDEFAANGEINDDYRISYLREHIRAMGEAIADGIPLMGYTTWG
CIDLVSASTGEMSKRYGFVYVDRDDAGNGTLTRTRKKSFWWYKKVIASNGEDLE
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtatttccgcaaggttttttatggggcggcgcgcttgccgccaaccagtctgaa
ggcgcgtaccgtgaaggcggcaaagggctgaccaccgtcgatatgatcccgcacggcgaa
catcgaatggcggtgaaactggggctggaaaaacgttttcagttgcgcgatgacgagttt
tatcccagccatgaggcgacggatttttatcatcgttataaagaagatatcgccctgatg
gcagagatgggattcaaggtttttcgcacctcgattgcctggagccgcctatttccgcag
ggcgatgaactgacgcccaatcagcagggcattgctttttaccgcgcggtatttgaagag
tgtaaaaagtacggtatcgaaccgctggtcacgttgtgtcacttcgacgtgccgatgcat
ctggttactgaatatggctcctggcgtaaccgcaagctggtagagcttttcagccgctac
gcccggacctgctttgaagcatttgatggtctggtgaaatactggcttaccttcaatgaa
atcaacattatgttgcatagcccgttctccggcgcgggtctggtgtttgaagaaggggaa
aatcaggatcaggtgaaatatcaggctgcgcatcaccagctggttgccagtgcgctagcc
accaaaatcgcccatgaggttaacccgcaaaatcaggtgggttgtatgctggcgggcggt
aacttctacccttacagctgcaagccggaagatgtctgggcggcgctggagaaagatcgg
gaaaacctgttttttatcgatgtgcaggcgcggggcgcgtatccggcttactctgcccgc
gtattccgcgaaaaaggggtaaccatcgacaaagcaccgagcgatgatgagatcctgaaa
aacaccgtcgattttgtctctttcagctattacgcctcgcgctgcgcctcggcggagatg
aacgccaacaactgcagtgcggcgaacgtggtgaaatcgctgcgtaacccgtatctgcaa
gtgagcgactggggctggggtattgatccactcggtctgcgtatcaccatgaatatgatg
tacgaccgttatcagaagccactgtttctggtggaaaacggcctgggcgcaaaagatgaa
tttgctgccaatggcgaaattaacgacgactatcgcatcagctatttacgcgaacatatc
cgcgcaatgggcgaagcgattgcagacggcattccgctgatgggctacaccacatggggc
tgtattgatttagtttccgcctctacgggtgaaatgagcaaacgctacggttttgtctac
gtagaccgtgacgacgcaggcaacggcacgctgacgcgcacgcgtaagaaatcgttctgg
tggtataaaaaagtgattgccagtaacggtgaagatttagagtaa

DBGET integrated database retrieval system