KEGG   Escherichia coli IHE3034: ECOK1_3555Help
Entry
ECOK1_3555        CDS       T01997                                 

Gene name
agaV
Definition
PTS system, N-acetylgalactosamine-specific, IIB component (EC:2.7.1.69)
Orthology
K02745  
PTS system, N-acetylgalactosamine-specific IIB component [EC:2.7.1.69]
Organism
eih  Escherichia coli IHE3034
Pathway
Galactose metabolism
Phosphotransferase system (PTS)
Module
PTS system, N-acetylgalactosamine-specific II component
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:eih00052]
Environmental Information Processing; Membrane transport; Phosphotransferase system (PTS) [PATH:eih02060]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3656200..3656673
Genome map
AA seq 157 aa AA seqDB search
MPNIVLSRIDERLIHGQVGVQWVGFAGANLVLVANDEVAEDLVQQNLMEMVLAEGIAVRF
WTLQKVIDNIHRAADRQKILLVCKTPADFLTLVKGGVPVNRINVGNMHYANGKQQIAKTV
SVDAGDIAAFNDLKAAGVECFVQGVPTEPAVDLFKLL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatattgttttaagtcggattgatgaacgcttgattcacggtcaggtcggcgtt
cagtgggtcggatttgcgggggcaaatctggtgctggtagccaacgacgaggttgccgaa
gatctggtacaacaaaacctgatggaaatggtactggcagaagggatcgccgtacgtttc
tggacgttgcaaaaagtcatcgataacattcatcgcgccgccgatcgacagaaaatcctg
ctggtttgtaaaacaccggccgatttcctgacgctggtgaaaggtggcgttccggtgaat
cgcattaacgttggcaatatgcactacgccaatggcaagcaacaaatcgccaaaacggtt
tctgtggatgcgggtgatatcgcagcatttaacgacctgaaagccgctggggtggaatgc
ttcgttcagggcgtcccgacagagcctgcagtggacctctttaaattactttga

DBGET integrated database retrieval system