KEGG   Escherichia coli IHE3034: ECOK1_3555Help
Entry
ECOK1_3555        CDS       T01997                                 

Gene name
agaV
Definition
PTS system, N-acetylgalactosamine-specific, IIB component (EC:2.7.1.69)
Orthology
K02745  
PTS system, N-acetylgalactosamine-specific IIB component [EC:2.7.1.69]
Organism
eih  Escherichia coli IHE3034
Pathway
Galactose metabolism
Phosphotransferase system (PTS)
Module
PTS system, N-acetylgalactosamine-specific II component
Brite
KEGG Orthology (KO) [BR:eih00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ECOK1_3555 (agaV)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    ECOK1_3555 (agaV)
Enzymes [BR:eih01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.69  protein-Npi-phosphohistidine---sugar phosphotransferase
     ECOK1_3555 (agaV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3656200..3656673
Genome map
AA seq 157 aa AA seqDB search
MPNIVLSRIDERLIHGQVGVQWVGFAGANLVLVANDEVAEDLVQQNLMEMVLAEGIAVRF
WTLQKVIDNIHRAADRQKILLVCKTPADFLTLVKGGVPVNRINVGNMHYANGKQQIAKTV
SVDAGDIAAFNDLKAAGVECFVQGVPTEPAVDLFKLL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatattgttttaagtcggattgatgaacgcttgattcacggtcaggtcggcgtt
cagtgggtcggatttgcgggggcaaatctggtgctggtagccaacgacgaggttgccgaa
gatctggtacaacaaaacctgatggaaatggtactggcagaagggatcgccgtacgtttc
tggacgttgcaaaaagtcatcgataacattcatcgcgccgccgatcgacagaaaatcctg
ctggtttgtaaaacaccggccgatttcctgacgctggtgaaaggtggcgttccggtgaat
cgcattaacgttggcaatatgcactacgccaatggcaagcaacaaatcgccaaaacggtt
tctgtggatgcgggtgatatcgcagcatttaacgacctgaaagccgctggggtggaatgc
ttcgttcagggcgtcccgacagagcctgcagtggacctctttaaattactttga

DBGET integrated database retrieval system