KEGG   Escherichia coli IHE3034: ECOK1_3972Help
Entry
ECOK1_3972        CDS       T01997                                 

Gene name
bcsZ
Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
eih  Escherichia coli IHE3034
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:eih00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4068673..4069770)
Genome map
AA seq 365 aa AA seqDB search
MRSGLVTMLLLAAFSVQAACTWPAWEQFKKDYISQEGRVIDPSDARKITTSEGQSYGMFF
ALAANDRAAFDNLLDWTQNNLAQGSLKEHLPAWLWGKKENSKWEVLDSNSASDGDVWMAW
SLLEAGRLWKEQRYTDIGSALLKRIAREEVVTVPGLGSMLLPGKVGFAEDNSWRFNPSYL
PPTLAQYFTRFGAPWTTLRETNQRLLLETAPKGFSPDWVRYEKDKGWQLKAEKTLISSYD
AIRVYMWVGMMPDSDPQKARMLNRFKPMATFTEKNGYPPEKVDVATGKAQGKGPVGFSAA
MLPFLQNRDAQAVQRQRVADNFPGSDAYYNYVLTLFGQGWDQHRFRFSTKGELLPDWGQE
CANSH
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtagtggactcgtgacgatgctgctgctggctgcctttagtgttcaggcagcctgt
acctggcctgcctgggagcagtttaaaaaggattacatcagtcaggaagggcgcgtcatc
gaccccagcgacgcgcgcaaaatcaccacctccgaagggcaaagttacggcatgttcttt
gccctggcggctaacgaccgtgcagctttcgataatcttctcgactggacgcagaacaat
ctcgctcagggttctttaaaagaacatttgcccgcctggctgtggggcaagaaagagaac
agtaagtgggaagtgctggacagcaattcggcctccgatggtgatgtctggatggcctgg
tcgttgctggaggcggggcgtttgtggaaagagcagcgttataccgacatcggcagcgca
ttgctaaaacgtatcgcgcgggaggaagtggtgacggtgcctgggctgggctccatgttg
ttaccgggcaaagtgggttttgctgaggataacagctggcgttttaaccccagctacctg
ccgccgacgctggcgcagtatttcacccgctttggcgcgccgtggaccacgctgcgcgaa
accaatcaacgtttattgctggaaaccgccccgaaaggcttttcgccagactgggtgcgc
tatgagaaagacaaaggctggcagctaaaagccgaaaaaacattgatcagcagctacgac
gctatccgcgtttacatgtgggtaggcatgatgcctgacagcgatccgcaaaaagcgcgg
atgctcaaccggtttaaaccgatggcgacattcactgagaaaaacggttatccgccggaa
aaagtggatgtggctacggggaaagcgcagggtaaaggaccggtcggtttttctgccgcc
atgctgccctttttacaaaaccgcgatgcgcaggccgttcagcgccagcgcgtggccgat
aactttcccggcagcgatgcctattacaactatgtgctgaccctgtttggacaaggctgg
gatcaacaccgtttccgcttctcgacaaaaggtgagttattacctgactggggccaggaa
tgcgcaaattcacactaa

DBGET integrated database retrieval system