KEGG   Escherichia coli IHE3034: ECOK1_4492Help
Entry
ECOK1_4492        CDS       T01997                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
eih  Escherichia coli IHE3034
Pathway
eih00630  Glyoxylate and dicarboxylate metabolism
eih01100  Metabolic pathways
eih01110  Biosynthesis of secondary metabolites
eih01120  Microbial metabolism in diverse environments
eih01200  Carbon metabolism
Module
eih_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eih00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ECOK1_4492 (aceA)
Enzymes [BR:eih01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     ECOK1_4492 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ADE91863
Structure
PDB: 

Jmol
Position
4617621..4618925
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELQKEWTQPRWEGITRPYSAEDVVKLRGSVNPECTLAQLGAAKMWRLLHGE
SKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLAASMYPDQSLYPANSVPAV
VERINNTFRRADQIQWSAGIEPGDPRYVDYFLPIVADAEAGFGGVLNAFELMKAMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVTGVPTLLVARTDADAADL
ITSDCDPHDSEFITGERTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLELARR
FAQAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKFQFITLAGIHSMWF
NMFDLANAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTIIQGGTS
SVTALTGSTEESQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacacaacaaattgaagaattacagaaagagtggactcaaccgcgttgg
gaaggcattactcgcccgtacagcgcggaagatgtggtgaaattacgcggttcagtcaat
ccggaatgcaccctggcgcaactgggcgcggcgaaaatgtggcgtctgctgcacggcgag
tcgaaaaaaggctacatcaacagcctcggtgcactgactggtggtcaggcgctgcaacag
gcgaaagcgggtattgaagcagtctatctgtcgggatggcaggtagcggcggacgctaac
ctggcggccagcatgtatccggatcagtcgctctatccggcaaactcggtgccagcggtg
gtggagcggatcaacaatactttccgccgtgcggatcagatccaatggtccgcgggcatt
gagccgggcgatccgcgctatgtcgattacttcctgccgatcgtcgccgatgcggaggcc
ggttttggcggtgtactgaatgcctttgaactgatgaaagcgatgattgaagccggtgca
gcggcagttcacttcgaagatcagctggcatcagtgaagaaatgtggtcacatgggcggc
aaagttttggtgccaactcaggaagctattcagaaactggtcgcggcgcgtctggcagct
gatgtgacgggcgttccaaccctgctggttgctcgtaccgatgccgatgcggcggatctg
attacctccgattgcgacccacatgacagcgaatttattactggcgagcgtaccagtgaa
ggcttcttccgtactcatgcgggtattgagcaagcgatcagccgtggcctggcgtatgcg
ccatatgctgacctggtatggtgtgaaacctccacgccggacctggaactggcgcgtcgc
tttgcacaagccatccacgcgaaatatccgggcaaactgctggcttataactgctcgccg
tcgttcaactggcagaaaaacctcgacgacaaaactattgccagcttccagcagcagctg
tcggatatgggctacaagttccagttcatcaccctggcaggtatccacagcatgtggttc
aacatgtttgacctggcaaacgcctatgcccagggcgagggtatgaagcactatgttgag
aaagtgcagcagccggaatttgccgccgcgaaagatggctataccttcgtatctcaccag
caggaagtgggtacaggttacttcgataaagtgacgaccattattcagggcggcacgtcg
tcggttaccgcactgactggctccactgaagaatcgcagttctaa

DBGET integrated database retrieval system