KEGG   Escherichia coli IHE3034: ECOK1_4911Help
Entry
ECOK1_4911        CDS       T01997                                 

Definition
phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eih  Escherichia coli IHE3034
Brite
Enzymes [BR:eih01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ECOK1_4911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5048463..5048960
Genome map
AA seq 165 aa AA seqDB search
MSPSLRKAVAAAIGGGAVAIASVLITGPSGDDGLEGVSYIPYKDIVGVWTVCHGHTGKDI
IPGKTYTEAECKALLNKDLATVARQINPYIKADIPETTRGALYSFVYNVGAGNFRTSTLL
RKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCLWGQQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccatcattacgcaaggctgttgctgctgctattggtggtggggctgttgctata
gcgtctgtgctcatcactggtccaagtggtgacgatggtctggaaggtgtcagctacata
ccatacaaagatatcgttggtgtatggactgtatgtcacggacacaccggaaaagatatc
attcccggtaaaacgtataccgaagcagaatgcaaagccctcctgaataaagaccttgct
acggtcgccagacaaattaacccgtacatcaaagctgatataccagaaacaacacgcggc
gctctttactcgttcgtttacaacgtgggcgctggcaatttcagaacatcgacgcttctt
cgcaaaatcaaccagggcgatatcaaaggtgcatgtgatcaactacgtcgctggacatat
gctggcggtaagcaatggaaagggctgatgactcgccgtgagattgagcgtgaagtctgt
ttgtgggggcagcaatga

DBGET integrated database retrieval system