KEGG   Encephalitozoon intestinalis: Eint_010040Help
Entry
Eint_010040       CDS       T02238                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ein  Encephalitozoon intestinalis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ein00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Eint_010040
   00670 One carbon pool by folate
    Eint_010040
Enzymes [BR:ein01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Eint_010040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:7131..7745
Genome map
AA seq 204 aa AA seqDB search
MIALIVALAANQGIGRHGKLPWKHPLKTDMAWFRILSQSVPILSPDHISLSPSKSNVVVM
GRKTWHSIPSRFRPLQNRINVVLSRSSLPHSQNTFFIPSFAALDHLPLPPSPATFVIGGH
DIYALAIQTGRVQAMFVTEVHESPECDVFFPQVDWSSYQKRDITRDVARLVDTTLVDAFY
IPEENIFNEGGISFKMFIYTKLHP
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgattgccttaattgtggctcttgctgcaaaccaaggcataggaagacacgggaaactc
ccctggaaacatcccctcaagacagacatggcctggttcagaatcctctcccagagcgtc
cctatcctttcccccgaccacatcagcctctccccctccaaatcaaatgtcgtcgtcatg
ggcagaaagacatggcactccatcccctcgcgcttcaggccccttcaaaaccgcatcaat
gtcgtcttgtcaagatcctccctcccccattcccagaacaccttcttcatcccaagcttc
gccgccctcgaccatctacctcttcccccatctcctgcaacctttgtcatcggaggacat
gacatctatgcccttgcaatccagacaggcagggtccaggccatgtttgtcacagaggtc
cacgagtccccagaatgcgatgtgttcttccctcaggtcgactggtcttcctaccaaaag
agagacatcactcgcgatgtcgccaggcttgtggacaccacccttgtagatgccttctac
atcccagaagaaaacatcttcaacgaaggcggcatctccttcaagatgttcatttacacc
aaactacatccttag

DBGET integrated database retrieval system