KEGG   Encephalitozoon intestinalis: Eint_010550Help
Entry
Eint_010550       CDS       T02238                                 

Definition
RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH subunit TFB2
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ein  Encephalitozoon intestinalis
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ein00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Eint_010550
  Replication and repair
   03420 Nucleotide excision repair
    Eint_010550
Transcription machinery [BR:ein03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Eint_010550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:58725..59969
Genome map
AA seq 414 aa AA seqDB search
MENEVSQAWPYPIDIIEYFGMLPEHSKKRLYRAPVFAVSFLKIFDEKTTRFIFDLLLKSH
SISSLREIKGIKEVLKTLLRIQMIEKKGDNIYLEEDFRRSLMEGFCMLTIEKHYRSAGEE
TETDEEESNRRFETILRSIVNKESKIREFGVREVLMFGGLLGRDENITNRGFEFLLKTKK
EQLWCLVLLSLKYFLKSVEEEVSTLEAIFELSTKNVGTVYRHSSSMDKRLLKYLEVLGIL
KLYGENLAIRRSFVQLFEASERNRREFIIVETNNKIYAYTNSEYEKSVIHLFCNVSFNLP
NLTKGSITEESVNAAFDKGITGRQIIHFLEASSKPGSLPPAIINQIIIWESKRNRIFMAP
GYLYSNFLNLSDYQKVLEFCSERNYLIESDIDRRMIVVNPKGHVFVKEFIKTIL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgaagtctcacaagcctggccatatccaatagacatcatagagtattttggt
atgcttcccgaacactcgaagaagcggctgtatagggctcctgtgtttgcagtatctttc
ctgaagatctttgacgaaaagaccacacgatttatctttgatctattgctgaaatcccac
tccataagttctctgagagagatcaaagggattaaggaagtcctgaaaacactactgagg
atccagatgatcgagaaaaaaggagataacatttacttagaggaagacttcaggagatcg
ctgatggaagggttttgcatgcttacgatagaaaagcactatagaagtgcaggagaagag
acggaaaccgatgaagaggagagtaatagaaggtttgaaactattctaaggtcgattgtc
aataaggagagcaagatcagggaatttggagtcagggaagtccttatgtttggagggctc
cttggcagggatgagaacatcacaaacagagggtttgaatttcttctcaaaacaaagaaa
gagcaactgtggtgtcttgtgttactgtccttgaagtattttctcaaatctgtggaggaa
gaagtttccacgttggaagctatatttgagctgagtacaaagaatgttggaacagtatac
cgccattccagttcaatggataaaagactgctcaaatatctggaggtactggggatcttg
aagctctatggagaaaaccttgcgattaggaggtcctttgtacagctgtttgaggcgtct
gaacgcaacagaagagagtttataattgtggaaacaaacaacaagatatatgcatacaca
aattccgagtatgaaaagtctgtgatacatctgttctgcaacgtgtctttcaaccttcct
aaccttacaaagggaagtataacagaggagagtgtgaatgctgcatttgacaaaggaata
acaggaagacaaataatacactttctggaggcaagttccaaacccggaagccttcctccg
gcgatcatcaaccagataattatatgggagtccaagagaaacaggatcttcatggctcct
ggatatctttactcgaacttcctgaatttgtctgactatcagaaggtactggagttctgc
agcgaaagaaactatcttatagaatccgacatcgacaggaggatgatagttgtgaatcca
aaaggtcatgtgtttgttaaggagttcataaagacaatactctaa

DBGET integrated database retrieval system