KEGG   Encephalitozoon intestinalis: Eint_011150Help
Entry
Eint_011150       CDS       T02238                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ein  Encephalitozoon intestinalis
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ein00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(120983..121537)
Genome map
AA seq 184 aa AA seqDB search
MDKAHLVLTGPSGSGKSTIISHILSRFPFGFSVSHTTRQPRKGEVNGKDYFFVTTEEFES
MVKRQELLEYIKYNGNYYGTGSDQLKVSEKAILMDLEYDGVMYCRKNYPNFVVVYIDCDK
DVAYERLKKRMENKNREDEVKGRMKLYEKFDSIKKDCDYVIDNTHSLERSKKEIEEIISK
EFKF
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggataaggcacatctagtactcaccgggcccagtggatccggaaagtccactatcata
agtcacattctatctaggtttccttttgggttttcggtgtcacacacaaccaggcaaccg
agaaaaggagaggtgaatggaaaggattatttttttgtgacaacagaagagtttgagtcg
atggtaaaaagacaggaacttttggagtatatcaaatacaatggaaactactatggaaca
ggttctgaccagctgaaggtctctgaaaaggcaatattgatggatttggaatatgatgga
gtcatgtattgtagaaagaactacccaaacttcgttgttgtgtatattgattgtgataaa
gatgttgcctatgagaggttaaagaagaggatggaaaacaaaaacagggaggatgaagtg
aaggggagaatgaagttatatgaaaaattcgattctatcaagaaagactgcgactatgtc
atcgacaacactcattctcttgagaggtccaaaaaggaaattgaagagattatatccaag
gaattcaagttctag

DBGET integrated database retrieval system