KEGG   Encephalitozoon intestinalis: Eint_020440Help
Entry
Eint_020440       CDS       T02238                                 

Definition
Mps1-like Thr/Tyr dual specificity protein kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ein  Encephalitozoon intestinalis
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:ein04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:47630..49378
Genome map
AA seq 582 aa AA seqDB search
MEGIFNSKDLYEYLEEQKHSGISKTRRISLYYKATSKSVGDDEYSLRIWLDYIQLLMDGT
KDTTEARETFKMIKMRFCKFYNYWEAYIRFEIETGNENLGKILQHSIDFVKVKEFPEKKN
VLDYLECVISYVRNQQDLSVFCRSPEKSLDADGRFTSLFETQMGDRGGKILKKDQKEPRY
EYEGGRGLFPRNDDIYSTPGECKENLSNRSKTDSSSQTLLSSLDTKTGNHGSSFFGTIPV
RFEKEDYSQGITAEINAALGKAGSEESSSSPRSGTIRAREKISVKGKDIEILKQIGKGGS
SKVYKILLGNSVYALKRVELVGDEKMLNSYINEINLLYKFKGAPEIVEIIDHEVNEDYLH
ILLEYGETDLSQIIKRGNLSINFIKDVWEQMLLIVKRVHMERIIHCDLKPANFLFVKGRV
KLIDFGISKVIRNDTTSILSEEQCGTVNYMSPEAVTQNKSKVARSSDIWSLGCILYEMVH
SKPPLHEYPNLIQKIQKLQEYSEFKYSSENKLAVMVMKECLVRDPKKRPTIDNLLNHRFL
TGEIHLEPLRELVTKILRISGKDKADPAYVDKITEQLWNDHG
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggaagggatcttcaatagtaaggatctttacgaatacctcgaggagcaaaagcattcg
ggaatatcaaagaccagaaggatatccttgtactacaaggcaacatcgaaaagtgtggga
gacgacgaatactcattgaggatatggctggattacatccaattgcttatggatggaaca
aaagatacaacagaggccagggagacatttaagatgataaagatgagattttgtaagttc
tacaactattgggaagcttacatccgatttgagatagagacaggaaacgaaaatctcggg
aagattttgcagcacagcatcgattttgttaaagtgaaagagtttcccgaaaagaaaaat
gtgctggattatttggagtgtgtgatatcttatgtccgtaatcagcaagacttgtctgta
ttctgcagaagcccagagaaaagtcttgatgcagacggaaggttcaccagtctttttgag
acccaaatgggagaccgtggaggcaagattttgaagaaggatcagaaagagcccaggtat
gagtatgaaggagggagagggctctttccaagaaacgatgatatttactctacgcctgga
gaatgtaaagaaaacctgagcaatagaagcaagactgacagtagtagccagacattgctc
tccagcttggatacaaagactggaaatcacggtagttcattctttgggacaatacctgtt
agatttgagaaggaggattactcccagggaataactgcagagataaatgcagctttggga
aaagcaggttcggaggaaagcagctcatctcctcgatcgggaacgataagagccagggag
aagatatctgttaaagggaaggatattgaaatacttaagcaaataggaaagggaggaagt
agcaaggtgtacaaaattctcctgggaaacagtgtgtacgctttgaaaagagtcgaactt
gttggagacgaaaagatgcttaactcctatatcaacgagataaatctactttacaagttc
aagggggcgccggagatagttgagatcatagaccatgaggtaaatgaggactatctacac
attctactggaatatggagaaaccgatttatcccaaatcataaaaagaggaaacctaagc
ataaacttcattaaggatgtgtgggagcagatgctcctgatagtgaagagggttcacatg
gaaagaatcattcattgcgatcttaagcctgcaaacttcttgtttgtcaaaggacgtgtc
aagctcatagacttcgggatatccaaggtcataagaaacgacaccaccagcattctctct
gaagagcaatgtggaacagtaaactacatgtctccagaagcagttacgcaaaacaaatca
aaggtagcccgaagctcggacatttggtctctaggatgcatactgtatgaaatggttcat
tcgaagcctccgttgcatgaatatcctaatttgatccaaaagatccagaaactgcaagag
tactcggaattcaaatattcaagtgagaataaacttgccgtcatggttatgaaggagtgt
cttgtccgagatccaaaaaaaaggccaaccatagacaatcttcttaaccacaggttcctc
accggggaaatccatctagagccgctccgagagctggtaacaaaaatccttagaatcagt
ggaaaggacaaggctgacccagcatatgttgacaagataactgagcagctttggaatgac
catggataa

DBGET integrated database retrieval system