KEGG   Encephalitozoon intestinalis: Eint_021260Help
Entry
Eint_021260       CDS       T02238                                 

Definition
dolichyl-phosphate-mannose-protein O-mannosyl transferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ein  Encephalitozoon intestinalis
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:ein00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(142658..144670)
Genome map
AA seq 670 aa AA seqDB search
MAKSKYLEISTVLLIFTLSIVMKTYRIENGDFVVWDEAHFGKFSEKYLSRKFYFDVHPPL
GKILTSLGGYLFNQPLDFEFKSGEKFPKGFDYSGMRRFHSAIASFMPVLGYLMLKEMKYS
YKRRILLSLIFIFENGFTSIGRLILLDSHLLTFTAAVAYFMTRMYFRSKEKIDLASISLL
GITLGCVLSIKWIGFLTMSLVGLFTIYCLWCNITSKESILGFAKLFLMKAFFLICIPASL
YVLLFYIHFEMVNRSSSDDGHMSSLFQATLKGSDIGNNRKYPLFGTKVTIKSSKTGGGYL
HSHDHKYPNGENNQVTIYHHKDENNAWVLQKVTDDLEDAEFISSGDTVVLLHMETRKYLD
IPGNHSLMSSGLRAESSGSHLSDTNLFKIEIVEDAIKKEGRVKTLTTKFRLFSTKHNCYL
KPSSRKYPSWGFEQGEVICGAKKGEATLWNVEENTSAKLSEEKNPVYKEITRYPFSKKFV
EHNKAMFITNASFIQDEDLEPERIVSKPYEWFILKRGLRMTAWDGQNEKFYMFGNPLVWY
SSGICVILSPIVLLCRVISRKRKGKPLAFLRNEGYMVFLSCCGWLLHYIPFFFVKRVLYF
HHYYPALFFALFSLCYIMKFARLGFVAVFTFFVIVFFFLYSRLTYGFGEETEFLRRISII
PTWDFIEKGQ
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtccaaataccttgagatatctaccgtcctcttgatattcacattgagtata
gttatgaaaacctaccggatagagaacggagactttgttgtatgggatgaagcccatttt
gggaagttttcggagaaatatctatccagaaagttttactttgatgtccatcctcccctc
ggtaagatactaacttctcttggaggatatctttttaaccaacctctggacttcgaattt
aaatcaggagagaaatttcctaaaggatttgattattcgggaatgcggagatttcattct
gccatagcgtcttttatgccagttcttggatacctaatgcttaaagaaatgaagtattca
tacaagcgtagaattcttctttctttaatatttatatttgagaatgggtttacatccatt
ggaagactaatacttttggactcccatctcctgacatttacggctgcagttgcatacttc
atgactagaatgtactttagatctaaggaaaagatagatttggcctctatttctcttctg
ggaataactttgggctgcgtcctgagcattaagtggattggatttttgacaatgagcctg
gttggattgtttaccatctattgtctatggtgtaatattacctctaaagaaagcattttg
ggatttgccaagctgtttcttatgaaggcgttttttctgatttgtattccggcgtctttg
tacgttctattgttttacatccactttgagatggtaaacaggagtagtagcgacgatgga
catatgagctcactctttcaagcaaccctcaagggaagtgacataggtaacaacagaaaa
tatccattgtttggaactaaggtgacaattaagtcctccaagacaggaggaggatatctc
cattcccacgaccacaagtatccgaacggagagaataatcaagtaaccatctatcatcat
aaggacgaaaacaacgcctgggtacttcaaaaggtgactgatgacctagaagatgcagag
ttcatttcgtcaggtgacacagttgttcttctgcacatggagactaggaagtatttggac
attccaggcaaccattctcttatgtcaagtggtttgagagcagagtcctcaggaagccac
ctttccgatacgaacctgttcaaaatagaaatagtagaagacgccataaaaaaggagggc
cgagtaaaaactcttacaaccaaattcaggctgttcagcaccaaacataactgctatctc
aagccttcatcaagaaaatatccttcgtggggatttgagcagggagaggtcatctgtgga
gccaagaagggcgaggcaactctttggaatgtcgaggaaaacacatctgcaaagctgagc
gaagagaaaaatcctgtgtataaagagatcacaagatatccattttcaaagaagtttgtg
gagcataataaggctatgtttattacaaatgcttctttcattcaggatgaagatctggag
ccggaaagaattgtttcaaagccatatgagtggttcatcctcaaaagaggattaagaatg
accgcgtgggacggacagaacgagaagttctatatgtttggaaatccacttgtatggtac
tcttcaggaatttgtgtgattctttcaccgattgttcttctttgcagagtaatcagccga
aagcgaaaggggaaaccactggcattcctaaggaacgaaggatacatggtttttctgtct
tgttgtggatggctcctgcactacattccctttttctttgttaagagagtgctgtacttc
catcactattatcccgccttgttttttgcattgttttcattatgctatatcatgaaattt
gccagattgggatttgttgctgtgtttacgttttttgtgattgtatttttcttcctctac
tcaagactaacttacggatttggcgaggagacagaattccttagaagaatcagcataatc
cccacttgggacttcatagagaaaggacagtga

DBGET integrated database retrieval system