KEGG   Encephalitozoon intestinalis: Eint_030030Help
Entry
Eint_030030       CDS       T02238                                 

Definition
choline kinase-like protein
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
ein  Encephalitozoon intestinalis
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:ein00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Eint_030030
Enzymes [BR:ein01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Eint_030030
    2.7.1.82  ethanolamine kinase
     Eint_030030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:complement(2418..3566)
Genome map
AA seq 382 aa AA seqDB search
MNIILLLFSGIYILFGFCSQSKIVMKAIGGMNGVTSSNPNPSFSASIEHSSSEIPKHVVE
NIRKHIGSLPNGPMPRLSMAYSNVVYMFSVGKNRYIYKELKDFDAQDEMINNMVASERVI
VSTNKFRIERYLDSEHSIIKRDLKEIATELRRFHNIKASGIRSYKELVNNMMYKCIKEIL
PGEENNANPRDVIEKIKSLNQKSYKKDKDHIVRLLIEVQNRVFRVSTGDFESVTCHNDLQ
PGNILMVKTGVVFIDFEFVAMGSPVIDIANLFCEAAYDYENYVFQEENFPNTQERLEFIG
EYMDSNEHLEKMLELVEGAMAYSHFLWYLWALGNSRTGCSKNFDYSRYGNSRLHQLRVCG
IINHEEYEILQINKSELVNNTS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaatattatcctattattattttcaggaatatatattttgtttggattttgctcacag
agtaagattgtgatgaaggccattggagggatgaatggagtaacatcatcaaaccctaat
cctagcttttccgcgtctatagaacatagtagttccgagattccaaaacatgttgtggaa
aatataagaaagcatatagggtctcttccaaacggtcccatgcctcgtcttagtatggca
tatagtaatgttgtgtacatgttcagcgtgggaaagaaccgttacatttataaggaatta
aaagacttcgatgctcaggacgaaatgattaataacatggtagcaagcgaaagggtgata
gtgtcaactaacaagtttcggatagaaagatatttagattcggaacattcaatcatcaag
agggatttaaaagagattgcaacagaactccgaagatttcacaatataaaagctagcgga
atacggagttacaaggaactggtaaacaatatgatgtataagtgcatcaaagaaatacta
cctggcgaagaaaataatgcaaaccctagagatgtaatagagaagataaaatctttaaat
caaaagtcctataaaaaagataaggaccatatagtaagacttctaattgaagtgcagaat
agagtattcagagtatccactggagactttgaatcagtcacatgccataatgacctccaa
ccaggaaatatactgatggtaaaaacaggtgtagtttttatcgacttcgaatttgtagca
atgggttctcctgtaatcgacatagccaacctgttttgcgaggcagcttatgactacgaa
aactatgtatttcaggaagagaactttccaaatacccaagaaagactggaatttatagga
gaatatatggacagtaacgagcatttggaaaaaatgttggaactggtggagggagcaatg
gcgtacagccactttctatggtatctttgggcattaggcaatagccgtacaggttgttcc
aagaacttcgactattccagatatgggaactcacggctgcaccagttacgtgtttgtggg
atcataaaccatgaagaatacgaaatacttcagataaacaagtcagagcttgtgaataat
acttcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system