KEGG   Encephalitozoon intestinalis: Eint_030570Help
Entry
Eint_030570       CDS       T02238                                 

Definition
isopeptidase T
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
ein  Encephalitozoon intestinalis
Brite
Enzymes [BR:ein01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Eint_030570
Peptidases [BR:ein01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Eint_030570
Exosome [BR:ein04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Eint_030570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:69465..71195
Genome map
AA seq 576 aa AA seqDB search
MELPDLSKFREKCCYCYEDIKTGISVCSCGLSFCKEHKDLHLGKAKCQIVFEIKEIGNDL
GIEIKNTMLGEAEIEELRRRMETLVRSEDEDERVIFRDEEVVCMHECPEGPCSIDLGDAG
NLSCKVCDVKTRLWVCFICGYVGCGRMQYGAEGNGHARAHYEETQHNVFVLVPSLIKESC
EVFCYLCDSNIRFHYEIPGNITIDFGDEGKAGRKRVKKRIICNGIVEQEEKKLKAMEKGK
NESIPSPYVGIVNSGNTCYISSVLQMIGYVVSKEDIDMEQHFEICCDKNPLECFFCQLMR
VLNRMKKARKEKNIDSISILDLIILIWRDMPMFSKFMQQDSHEFLLFLLEKIREGEGLYL
IPSITSFFEFEVGRKISCSGCMDKSTSYESAMMICTCLKGDIRRSVEMFFSPDEWNCKCG
GKKNVSRFVTIPPRYLIIQVGRYSYNNNKVEKIKSKIGIKSVKLKDFMSKDEADESLAKK
LSDDGYSLEDAKRALGIFCNDEGKARSFLERQSSVVSPEDLKYRVVGCINHSGDNIKAGH
YTWWVYEDEKCYKIDDTNVLGSNVEVLEDGYIFLFK
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggagttaccagacctctctaaattcagagaaaagtgctgctactgctacgaagacatc
aagactgggatatctgtgtgtagctgtggtctttcgttctgcaaagaacacaaggatctt
caccttgggaaggccaaatgccaaattgtatttgagattaaggagattggaaatgatcta
ggtattgaaattaaaaacacaatgctcggggaagcggagattgaagaactaaggaggagg
atggagacattggtgaggtcggaggatgaggatgagagagtcatcttcagggacgaggaa
gtggtatgtatgcatgaatgtcctgaaggtccatgctctatagatctaggagatgctggg
aatcttagctgcaaggtgtgcgatgtgaaaacaagactgtgggtgtgttttatttgcggg
tatgttggatgcgggaggatgcagtatggtgcagaagggaatggacatgcaagggcacat
tatgaggaaacacaacacaatgtttttgttctagttcctagccttataaaagagagttgc
gaggtattctgctatctttgtgactcaaacataagatttcactacgagattcccgggaat
attacaattgactttggagatgagggaaaggcagggaggaaaagagtgaagaagaggata
atctgcaatgggattgttgagcaggaagaaaagaaattgaaggcgatggaaaagggaaag
aatgagtcgattcctagtccatatgtcgggattgttaactccggaaacacctgttatatt
tcttctgttctccaaatgataggatatgtagtttcgaaagaggacattgatatggagcaa
cacttcgagatatgctgtgataagaatcctctggagtgctttttctgccagctgatgagg
gttttaaacagaatgaaaaaggctaggaaagaaaagaatatagatagtatatcgatacta
gatctgataatacttatatggagagatatgcctatgttttcgaagtttatgcagcaagat
tcccacgagtttttacttttcctccttgagaagatacgggaaggagaaggtttatatctg
attccatcgataacatctttctttgagtttgaggttggaagaaagatcagctgttcagga
tgcatggataagtctaccagctatgaatctgcaatgatgatatgtacatgtctgaagggc
gacataagaaggtctgtggagatgtttttttctcctgatgagtggaactgcaagtgtggg
ggaaagaagaatgtaagtcggtttgtcacaattcctcccaggtatctaataatccaagtt
ggaagatactcttataataataacaaagtggagaagatcaaaagcaagatcgggataaaa
agtgtcaagctaaaagactttatgagcaaggacgaagccgacgaatccctcgccaaaaag
ctttcagatgatggatattccttggaggatgcaaaaagggctttaggcatcttctgcaac
gacgaaggtaaggcccgcagcttcctggaaaggcaaagttctgtagtctcgccagaagac
ttaaagtacagagttgtcggatgcatcaatcattctggagataatatcaaggcaggacat
tacacgtggtgggtgtatgaagatgaaaagtgttacaaaatagatgatacaaacgttctt
ggtagcaatgttgaagtattggaagatggctatatattcttgtttaaatga

DBGET integrated database retrieval system