KEGG   Encephalitozoon intestinalis: Eint_030590Help
Entry
Eint_030590       CDS       T02238                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ein  Encephalitozoon intestinalis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ein00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Eint_030590
   01230 Biosynthesis of amino acids
    Eint_030590
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Eint_030590
   00030 Pentose phosphate pathway
    Eint_030590
   00051 Fructose and mannose metabolism
    Eint_030590
   00052 Galactose metabolism
    Eint_030590
  Energy metabolism
   00680 Methane metabolism
    Eint_030590
Enzymes [BR:ein01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Eint_030590
Protein phosphatases and associated proteins [BR:ein01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Eint_030590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:complement(72013..74739)
Genome map
AA seq 908 aa AA seqDB search
MEAVIEELQLSGDGILQRHGEVYELLGLDVIYDRGTLKIYSTRKAKITSTSPGIHIHTSY
KALRRLTTRGLVNENGRGMPLEMMDMMGNKIVVTFSGQGKTNRIAIVTSGGDAPGMNSAI
KSITRTGIKWGASVYGVYNGYDGLINNNIRRLSWDTETHCSSQGGTVLLSARSQKFMGKE
GRKEAVLNMVRKKINCVIVLGGDGSMKGAMVLRDEFKDHLRDLIREGKISPRDLKRILNS
KAESKDEEKEKVTTETSGVGYSDFYGAPECYKETPMVYHDLNSSDDMLEDLQMDKCSCEE
MDLDEIEKYVYDLKVVGIPATIDNDICGVPISLGEDTAIHRVIEGIDHLMSTMKSHTRTF
VIEVMGRKCGWIALMSALASSADYVLLPEAPTEWKKEMIEALTTARRCGKAGTFVIVSEG
AVEKDGTPIHASQAVEEIAKFGMDVRLLKLGHIQRGGPTSAQDRIYGTLLGVKAVEISLG
PTKDPVMISIFRDEIFEIELKEVIERNNLVRDFQEKKLFEDVLKSRCNFFRLAYSYFRKS
LMTGIRNIRDKGCDCSSREKIETECSCGPDCRGKYEDRKPRIGVLQFGRRASGMNTVLNA
VVQYSLVAGAEPYYIPNGFEGLVNNQLIRAKPYEFFGDVNNGGSAIGVGGDLEVDIKLIQ
RKVVESGLDSLIIIGGSKALNTIKELKGVNIVLVPASSYNNIPKIDISIGADTALNTIIK
VSDVSKLNSFAYKNNVFVVEIGGENCGYLSLMGGIAAGAFEAFIPERKYLIGHLSEVAQR
LRVKFREKIRRGIVIFRNERTFRSIPTSSLCEILKTDSGDLFETNYSILGDVQQGLNPSP
IDRINATILGIEAVDLCLRKCGVGVVGFSKDKIEFTEISEVLKDFDHDLDRVKNPYWLKY
SNICRSVE
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgtcattgaggagttacaactatctggagacgggatactgcagaggcatgga
gaggtgtatgaactacttggtcttgatgtgatatatgatcgaggaacattgaagatatac
agcaccaggaaagccaagataacatctacaagccctggaatccacattcacacctcatac
aaagcactacggcgcttgaccacgcgagggcttgtcaacgagaacggccgtggaatgcca
cttgagatgatggacatgatgggaaacaagattgtggttacgttttctgggcaaggaaag
acgaataggattgcaattgtgacaagcgggggagatgcgccaggaatgaattcggcgatc
aagagcataacaaggacagggatcaagtggggagcatctgtatatggagtgtataacgga
tatgatggacttatcaacaataacatccgcaggctaagctgggatacagagacacattgc
agtagtcagggagggactgttctcctatctgcaaggtcccagaagtttatgggaaaagag
ggaaggaaagaggcagtactgaacatggtacggaagaagattaactgtgttatagtgcta
ggaggagatgggtctatgaagggagccatggttcttcgagacgagtttaaggatcatcta
agagatctcataagggaaggaaagatttctccccgcgatctgaagaggatactgaacagc
aaggcagaatcgaaggacgaagaaaaagagaaagtcaccaccgaaacaagcggggttgga
tattcggatttctatggagctcctgaatgttataaggagacacctatggtttaccatgat
cttaattcgtccgatgatatgctagaggacttgcaaatggacaaatgctcttgtgaagaa
atggacctggacgaaatagaaaagtatgtctatgacctgaaggttgtgggaataccggca
accatagacaacgacatctgtggggttcccatttcgttaggggaagatactgccatccac
agagttattgaaggaatcgatcatctaatgtctacaatgaaatcgcatacccggacgttt
gtcattgaggttatggggaggaagtgtggatggatagctcttatgtctgcattggcgagt
tctgcagactatgttttgcttcctgaggcacctaccgagtggaaaaaggaaatgattgag
gcacttacaacagcaagaaggtgcgggaaggcagggacttttgttatagtttcggaggga
gctgttgagaaggatgggacgcccatacatgcatcccaagctgtggaagaaattgccaag
tttggaatggatgtccggctcctcaagctagggcatattcagaggggtgggccgacttct
gcacaggataggatatatggtactctcctcggggtcaaggctgtggagatatcgttgggg
cctacaaaggacccggtgatgatcagcatctttagggacgagatctttgagattgaatta
aaagaggttatagaaagaaacaatctggtcagagatttccaggaaaagaaattgtttgaa
gatgttctgaaaagtaggtgtaacttcttcaggctggcttattcatactttagaaagtct
ttgatgacaggaattcggaacataagagataagggctgtgactgtagctccagggagaag
atcgaaaccgaatgcagttgtgggccagactgcagagggaaatatgaagatagaaagcct
cggataggagtgcttcagtttggacggcgagcaagtgggatgaacacggtgttgaatgct
gtagttcaatattctctggtggctggagcagagccatattacataccaaatgggtttgaa
ggtcttgtgaacaatcaacttataagggctaagccctatgaattctttggagatgtcaac
aacgggggatctgcaataggagttggtggagacttggaggtggacataaagctgatccaa
aggaaggtagttgagtctggactggactcactgattattataggagggagcaaagccttg
aatacaatcaaggagctcaaaggggtgaacattgtcctcgtgcctgcatcatcttacaac
aacattcctaaaatagacataagcattggagcagacacagccctcaacacaattataaag
gtgtcggacgtgtcaaagctaaactcgtttgcatataagaacaatgtctttgtggtggaa
attggaggggagaactgcggatatctatcgctaatgggaggaatagctgcaggtgcattt
gaagcttttatcccagagcgaaagtatctcataggacatctctccgaagtggcacagaga
ctccgtgtgaagttcagggaaaagataagaagaggaattgtgatattccgaaatgaaaga
accttccggtcaattcctacgagcagcttatgtgagatcttaaagaccgacagtggagat
ctatttgaaacaaactactcaattctcggagatgtccagcaaggactaaatccatcacca
atagacagaataaatgccacaattctggggattgaagctgttgacctatgtcttcgcaaa
tgcggagttggggttgttggattctcaaaggataagattgaattcacagagatctcagaa
gttttgaaagactttgaccatgacctcgaccgagtgaagaatccttattggctcaagtac
tccaacatttgcagatcggttgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system