KEGG   Encephalitozoon intestinalis: Eint_030590Help
Entry
Eint_030590       CDS       T02238                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ein  Encephalitozoon intestinalis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ein01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ein01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ein00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ein00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ein00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ein00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ein00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:complement(72013..74739)
Genome map
AA seq 908 aa AA seqDB search
MEAVIEELQLSGDGILQRHGEVYELLGLDVIYDRGTLKIYSTRKAKITSTSPGIHIHTSY
KALRRLTTRGLVNENGRGMPLEMMDMMGNKIVVTFSGQGKTNRIAIVTSGGDAPGMNSAI
KSITRTGIKWGASVYGVYNGYDGLINNNIRRLSWDTETHCSSQGGTVLLSARSQKFMGKE
GRKEAVLNMVRKKINCVIVLGGDGSMKGAMVLRDEFKDHLRDLIREGKISPRDLKRILNS
KAESKDEEKEKVTTETSGVGYSDFYGAPECYKETPMVYHDLNSSDDMLEDLQMDKCSCEE
MDLDEIEKYVYDLKVVGIPATIDNDICGVPISLGEDTAIHRVIEGIDHLMSTMKSHTRTF
VIEVMGRKCGWIALMSALASSADYVLLPEAPTEWKKEMIEALTTARRCGKAGTFVIVSEG
AVEKDGTPIHASQAVEEIAKFGMDVRLLKLGHIQRGGPTSAQDRIYGTLLGVKAVEISLG
PTKDPVMISIFRDEIFEIELKEVIERNNLVRDFQEKKLFEDVLKSRCNFFRLAYSYFRKS
LMTGIRNIRDKGCDCSSREKIETECSCGPDCRGKYEDRKPRIGVLQFGRRASGMNTVLNA
VVQYSLVAGAEPYYIPNGFEGLVNNQLIRAKPYEFFGDVNNGGSAIGVGGDLEVDIKLIQ
RKVVESGLDSLIIIGGSKALNTIKELKGVNIVLVPASSYNNIPKIDISIGADTALNTIIK
VSDVSKLNSFAYKNNVFVVEIGGENCGYLSLMGGIAAGAFEAFIPERKYLIGHLSEVAQR
LRVKFREKIRRGIVIFRNERTFRSIPTSSLCEILKTDSGDLFETNYSILGDVQQGLNPSP
IDRINATILGIEAVDLCLRKCGVGVVGFSKDKIEFTEISEVLKDFDHDLDRVKNPYWLKY
SNICRSVE
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgtcattgaggagttacaactatctggagacgggatactgcagaggcatgga
gaggtgtatgaactacttggtcttgatgtgatatatgatcgaggaacattgaagatatac
agcaccaggaaagccaagataacatctacaagccctggaatccacattcacacctcatac
aaagcactacggcgcttgaccacgcgagggcttgtcaacgagaacggccgtggaatgcca
cttgagatgatggacatgatgggaaacaagattgtggttacgttttctgggcaaggaaag
acgaataggattgcaattgtgacaagcgggggagatgcgccaggaatgaattcggcgatc
aagagcataacaaggacagggatcaagtggggagcatctgtatatggagtgtataacgga
tatgatggacttatcaacaataacatccgcaggctaagctgggatacagagacacattgc
agtagtcagggagggactgttctcctatctgcaaggtcccagaagtttatgggaaaagag
ggaaggaaagaggcagtactgaacatggtacggaagaagattaactgtgttatagtgcta
ggaggagatgggtctatgaagggagccatggttcttcgagacgagtttaaggatcatcta
agagatctcataagggaaggaaagatttctccccgcgatctgaagaggatactgaacagc
aaggcagaatcgaaggacgaagaaaaagagaaagtcaccaccgaaacaagcggggttgga
tattcggatttctatggagctcctgaatgttataaggagacacctatggtttaccatgat
cttaattcgtccgatgatatgctagaggacttgcaaatggacaaatgctcttgtgaagaa
atggacctggacgaaatagaaaagtatgtctatgacctgaaggttgtgggaataccggca
accatagacaacgacatctgtggggttcccatttcgttaggggaagatactgccatccac
agagttattgaaggaatcgatcatctaatgtctacaatgaaatcgcatacccggacgttt
gtcattgaggttatggggaggaagtgtggatggatagctcttatgtctgcattggcgagt
tctgcagactatgttttgcttcctgaggcacctaccgagtggaaaaaggaaatgattgag
gcacttacaacagcaagaaggtgcgggaaggcagggacttttgttatagtttcggaggga
gctgttgagaaggatgggacgcccatacatgcatcccaagctgtggaagaaattgccaag
tttggaatggatgtccggctcctcaagctagggcatattcagaggggtgggccgacttct
gcacaggataggatatatggtactctcctcggggtcaaggctgtggagatatcgttgggg
cctacaaaggacccggtgatgatcagcatctttagggacgagatctttgagattgaatta
aaagaggttatagaaagaaacaatctggtcagagatttccaggaaaagaaattgtttgaa
gatgttctgaaaagtaggtgtaacttcttcaggctggcttattcatactttagaaagtct
ttgatgacaggaattcggaacataagagataagggctgtgactgtagctccagggagaag
atcgaaaccgaatgcagttgtgggccagactgcagagggaaatatgaagatagaaagcct
cggataggagtgcttcagtttggacggcgagcaagtgggatgaacacggtgttgaatgct
gtagttcaatattctctggtggctggagcagagccatattacataccaaatgggtttgaa
ggtcttgtgaacaatcaacttataagggctaagccctatgaattctttggagatgtcaac
aacgggggatctgcaataggagttggtggagacttggaggtggacataaagctgatccaa
aggaaggtagttgagtctggactggactcactgattattataggagggagcaaagccttg
aatacaatcaaggagctcaaaggggtgaacattgtcctcgtgcctgcatcatcttacaac
aacattcctaaaatagacataagcattggagcagacacagccctcaacacaattataaag
gtgtcggacgtgtcaaagctaaactcgtttgcatataagaacaatgtctttgtggtggaa
attggaggggagaactgcggatatctatcgctaatgggaggaatagctgcaggtgcattt
gaagcttttatcccagagcgaaagtatctcataggacatctctccgaagtggcacagaga
ctccgtgtgaagttcagggaaaagataagaagaggaattgtgatattccgaaatgaaaga
accttccggtcaattcctacgagcagcttatgtgagatcttaaagaccgacagtggagat
ctatttgaaacaaactactcaattctcggagatgtccagcaaggactaaatccatcacca
atagacagaataaatgccacaattctggggattgaagctgttgacctatgtcttcgcaaa
tgcggagttggggttgttggattctcaaaggataagattgaattcacagagatctcagaa
gttttgaaagactttgaccatgacctcgaccgagtgaagaatccttattggctcaagtac
tccaacatttgcagatcggttgaataa

DBGET integrated database retrieval system