KEGG   Encephalitozoon intestinalis: Eint_030590Help
Entry
Eint_030590       CDS       T02238                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ein  Encephalitozoon intestinalis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ein00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Eint_030590
   01230 Biosynthesis of amino acids
    Eint_030590
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Eint_030590
   00030 Pentose phosphate pathway
    Eint_030590
   00051 Fructose and mannose metabolism
    Eint_030590
   00052 Galactose metabolism
    Eint_030590
  Energy metabolism
   00680 Methane metabolism
    Eint_030590
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Eint_030590
Enzymes [BR:ein01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Eint_030590
Protein phosphatases and associated proteins [BR:ein01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Eint_030590
Messenger RNA biogenesis [BR:ein03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Eint_030590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:complement(72013..74739)
Genome map
AA seq 908 aa AA seqDB search
MEAVIEELQLSGDGILQRHGEVYELLGLDVIYDRGTLKIYSTRKAKITSTSPGIHIHTSY
KALRRLTTRGLVNENGRGMPLEMMDMMGNKIVVTFSGQGKTNRIAIVTSGGDAPGMNSAI
KSITRTGIKWGASVYGVYNGYDGLINNNIRRLSWDTETHCSSQGGTVLLSARSQKFMGKE
GRKEAVLNMVRKKINCVIVLGGDGSMKGAMVLRDEFKDHLRDLIREGKISPRDLKRILNS
KAESKDEEKEKVTTETSGVGYSDFYGAPECYKETPMVYHDLNSSDDMLEDLQMDKCSCEE
MDLDEIEKYVYDLKVVGIPATIDNDICGVPISLGEDTAIHRVIEGIDHLMSTMKSHTRTF
VIEVMGRKCGWIALMSALASSADYVLLPEAPTEWKKEMIEALTTARRCGKAGTFVIVSEG
AVEKDGTPIHASQAVEEIAKFGMDVRLLKLGHIQRGGPTSAQDRIYGTLLGVKAVEISLG
PTKDPVMISIFRDEIFEIELKEVIERNNLVRDFQEKKLFEDVLKSRCNFFRLAYSYFRKS
LMTGIRNIRDKGCDCSSREKIETECSCGPDCRGKYEDRKPRIGVLQFGRRASGMNTVLNA
VVQYSLVAGAEPYYIPNGFEGLVNNQLIRAKPYEFFGDVNNGGSAIGVGGDLEVDIKLIQ
RKVVESGLDSLIIIGGSKALNTIKELKGVNIVLVPASSYNNIPKIDISIGADTALNTIIK
VSDVSKLNSFAYKNNVFVVEIGGENCGYLSLMGGIAAGAFEAFIPERKYLIGHLSEVAQR
LRVKFREKIRRGIVIFRNERTFRSIPTSSLCEILKTDSGDLFETNYSILGDVQQGLNPSP
IDRINATILGIEAVDLCLRKCGVGVVGFSKDKIEFTEISEVLKDFDHDLDRVKNPYWLKY
SNICRSVE
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgtcattgaggagttacaactatctggagacgggatactgcagaggcatgga
gaggtgtatgaactacttggtcttgatgtgatatatgatcgaggaacattgaagatatac
agcaccaggaaagccaagataacatctacaagccctggaatccacattcacacctcatac
aaagcactacggcgcttgaccacgcgagggcttgtcaacgagaacggccgtggaatgcca
cttgagatgatggacatgatgggaaacaagattgtggttacgttttctgggcaaggaaag
acgaataggattgcaattgtgacaagcgggggagatgcgccaggaatgaattcggcgatc
aagagcataacaaggacagggatcaagtggggagcatctgtatatggagtgtataacgga
tatgatggacttatcaacaataacatccgcaggctaagctgggatacagagacacattgc
agtagtcagggagggactgttctcctatctgcaaggtcccagaagtttatgggaaaagag
ggaaggaaagaggcagtactgaacatggtacggaagaagattaactgtgttatagtgcta
ggaggagatgggtctatgaagggagccatggttcttcgagacgagtttaaggatcatcta
agagatctcataagggaaggaaagatttctccccgcgatctgaagaggatactgaacagc
aaggcagaatcgaaggacgaagaaaaagagaaagtcaccaccgaaacaagcggggttgga
tattcggatttctatggagctcctgaatgttataaggagacacctatggtttaccatgat
cttaattcgtccgatgatatgctagaggacttgcaaatggacaaatgctcttgtgaagaa
atggacctggacgaaatagaaaagtatgtctatgacctgaaggttgtgggaataccggca
accatagacaacgacatctgtggggttcccatttcgttaggggaagatactgccatccac
agagttattgaaggaatcgatcatctaatgtctacaatgaaatcgcatacccggacgttt
gtcattgaggttatggggaggaagtgtggatggatagctcttatgtctgcattggcgagt
tctgcagactatgttttgcttcctgaggcacctaccgagtggaaaaaggaaatgattgag
gcacttacaacagcaagaaggtgcgggaaggcagggacttttgttatagtttcggaggga
gctgttgagaaggatgggacgcccatacatgcatcccaagctgtggaagaaattgccaag
tttggaatggatgtccggctcctcaagctagggcatattcagaggggtgggccgacttct
gcacaggataggatatatggtactctcctcggggtcaaggctgtggagatatcgttgggg
cctacaaaggacccggtgatgatcagcatctttagggacgagatctttgagattgaatta
aaagaggttatagaaagaaacaatctggtcagagatttccaggaaaagaaattgtttgaa
gatgttctgaaaagtaggtgtaacttcttcaggctggcttattcatactttagaaagtct
ttgatgacaggaattcggaacataagagataagggctgtgactgtagctccagggagaag
atcgaaaccgaatgcagttgtgggccagactgcagagggaaatatgaagatagaaagcct
cggataggagtgcttcagtttggacggcgagcaagtgggatgaacacggtgttgaatgct
gtagttcaatattctctggtggctggagcagagccatattacataccaaatgggtttgaa
ggtcttgtgaacaatcaacttataagggctaagccctatgaattctttggagatgtcaac
aacgggggatctgcaataggagttggtggagacttggaggtggacataaagctgatccaa
aggaaggtagttgagtctggactggactcactgattattataggagggagcaaagccttg
aatacaatcaaggagctcaaaggggtgaacattgtcctcgtgcctgcatcatcttacaac
aacattcctaaaatagacataagcattggagcagacacagccctcaacacaattataaag
gtgtcggacgtgtcaaagctaaactcgtttgcatataagaacaatgtctttgtggtggaa
attggaggggagaactgcggatatctatcgctaatgggaggaatagctgcaggtgcattt
gaagcttttatcccagagcgaaagtatctcataggacatctctccgaagtggcacagaga
ctccgtgtgaagttcagggaaaagataagaagaggaattgtgatattccgaaatgaaaga
accttccggtcaattcctacgagcagcttatgtgagatcttaaagaccgacagtggagat
ctatttgaaacaaactactcaattctcggagatgtccagcaaggactaaatccatcacca
atagacagaataaatgccacaattctggggattgaagctgttgacctatgtcttcgcaaa
tgcggagttggggttgttggattctcaaaggataagattgaattcacagagatctcagaa
gttttgaaagactttgaccatgacctcgaccgagtgaagaatccttattggctcaagtac
tccaacatttgcagatcggttgaataa

DBGET integrated database retrieval system