KEGG   Encephalitozoon intestinalis: Eint_050050Help
Entry
Eint_050050       CDS       T02238                                 

Definition
patatin-like phospholipase domain containing protein 6
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
ein  Encephalitozoon intestinalis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ein00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Eint_050050
Enzymes [BR:ein01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Eint_050050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:8850..11567
Genome map
AA seq 905 aa AA seqDB search
MMLLVFLIVIMIMTGLLAGFKHYGSSKYRTIPFKIKSRAPEKIASTRLLGMTIEDAMKRH
PLFNFYPRQSIKEILESWDRVKYKNGDIITTPGFILQGCVEIWYGNSLTCIKEKGSFLNG
SMELLGYTTRGIKKAKGFVEVLLVDASLARTDVWYILFSMVRKSCIEVACKYFELEGKLV
EKETMKIGGDGMSHLDLFLDFLNRKFLQGLDDGKEALKKSIETRFVGKGEVLKDSGEPMD
YIVYVVSGEIQVLAGENAFSFGNGSLFGYFSLFFDSYSSIKILAKGDSSILICNSSVLFK
LGLDEKRFDHSMLLDIDECLHVIDESVEWIRLSPGDMIVQKGGTSKEIFYIAAGSIKSAS
KEFSSGMAIGDRECIFGENWGESFVATKITDIVRIPSLLVDYFFENDKTFFKKYTKRLFE
NGSRKNGKIVSIIPIGQYRDIESFSRRLRAAIGASSLLLNRKDVVDILARRSFDTTEELG
FMDYLTKMSKRYEIILIYVENEYSRLLRYLLNFSDILLTVGTTFADIPEYNVYCRIEFVK
IYEERKALNERSMRKREKTAPSRTGNANEKETPRQYDRIHHVLFPSKTILFCSKDFQRLA
RSLLGKRIGLVLGGGGARGLAHIGVIQALEEEGIPIDCVGGTSMGAFIGALYARECNNYY
VFKQAKRFSRKMSNIWLLLLDLTYPICSMFSGHGFNRSLHSVFGDSLIQDLWLEYFCITT
NISNYEEEVHRNGMIWRYVRASMGLCGYLPPICDNKKLLVDGGYLNNVPADVMMSMQVEK
IITVDVGTVLENDYFDYGDTLSGFTILFNRFFGNKKFVTMEEIQYRLAYISTERKTKELQ
ANGNIVMLKPDLGKYRTMDFKKFDEIVACGYQSTKDAISEWKRKGIFDTLFLNLKKQTPK
RRYSV
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgatgttattagttttcctaattgtaataatgattatgaccgggttgctggctgggttc
aagcattatggctcttcaaagtacagaacaattccttttaagataaaatcaagagctccc
gagaagattgcatctacaaggctacttgggatgactatagaagatgctatgaagagacat
ccgctattcaatttctacccaagacagtcaatcaaagagattttagaaagctgggataga
gtaaagtataaaaatggggacataataacaacgcctggatttatattacaaggttgtgtg
gagatatggtatggaaattcccttacctgcataaaagaaaaaggctcttttcttaatgga
tctatggagcttttaggatataccacaagaggaattaagaaggcaaaaggctttgttgag
gttctcttggttgatgcctctttagccagaaccgatgtatggtatatcttgttttccatg
gttagaaagtcatgtatcgaggtagcttgcaagtattttgagttggaaggcaagcttgta
gaaaaagaaactatgaagattggaggtgacggaatgagccatctagatttgtttctagat
tttctgaacagaaagtttttgcaaggcttggatgatggaaaggaggcacttaaaaagagc
attgaaactagatttgttggtaaaggtgaggttcttaaggactctggagagcctatggat
tatattgtgtatgtggtttccggagagattcaggtactagcgggagaaaatgcttttagt
tttggaaatggatccctgtttggatatttttccttattttttgattcatattcgtccatc
aagattctggcaaagggagattcctcgattcttatatgcaattcatcggttctgttcaaa
cttggcctggatgaaaaaagatttgatcattctatgttactggatatcgacgagtgtctc
catgtaatagatgagtcagtcgaatggataaggctttccccaggggatatgattgttcaa
aaaggaggcacttcgaaggagatcttctacattgcggctggaagcataaagtctgcttcg
aaggagttttcttctggaatggcgataggggatagggaatgcatctttggggaaaattgg
ggcgaatcttttgtggcaaccaaaataaccgatattgttcggattccatctcttttagta
gactatttctttgaaaatgacaagactttcttcaaaaagtacaccaaaagactgtttgag
aatggaagtagaaagaatggaaaaatagtcagcatcattccgattgggcaatatagggat
attgagtctttttcaagaaggctacgagcagcaatcggagcttcttcattgcttttgaac
cgtaaggatgttgttgacattcttgcaagaagatcgtttgatacgactgaggagctcggg
ttcatggattaccttacaaagatgtctaagcgctatgaaataattcttatttacgtagag
aacgaatattctagattattgaggtacttgctaaacttttcggacattttgttgacagtt
ggaacaacatttgccgacattcccgagtacaatgtttactgtcgaatagaatttgtcaaa
atctacgaggaaagaaaggctttaaacgaaaggagcatgaggaagcgagagaaaactgca
ccttctcgcaccgggaacgcgaatgaaaaagagacgccgagacaatatgaccggattcat
catgttctctttccctcgaaaaccattcttttctgttccaaggactttcagaggctggcg
agatcgttattaggaaaaagaataggactagttttaggaggaggaggagcaagaggactg
gctcatattggagttattcaggcacttgaagaggagggaattcccatagattgtgttgga
ggaacgagcatgggagcatttatcggcgccttgtatgcaagggaatgcaataactattat
gtgtttaagcaggcaaaaagattttctagaaagatgtccaacatatggcttctccttcta
gacttaacttatcccatctgctctatgttctcggggcacggattcaacaggtcactccat
tctgtgtttggtgatagtctaatacaagatctgtggctggagtatttctgtatcaccacc
aatatatctaactacgaagaagaggtgcacagaaacggaatgatttggagatatgtgcgt
gcaagcatggggctctgtggatatctgcctcctatatgtgataacaaaaaactactagtt
gatggaggatacttgaacaacgttcctgctgatgtgatgatgagtatgcaagtggagaaa
atcattactgtggatgttgggacggttctagaaaatgattactttgattatggagacacc
cttagtggatttaccatcctattcaataggttctttggcaacaagaaatttgtgacgatg
gaagagattcaatatagactggcctatatctctacagagcgaaagacaaaagagctccag
gcaaacggaaatatagttatgctaaagcctgatcttggaaaatatagaacgatggacttt
aagaagtttgacgaaattgttgcatgtggataccagtctaccaaagatgcaatctccgaa
tggaagcggaaaggaatcttcgatactctctttctcaatctaaaaaaacaaacaccaaaa
agaagatattccgtgtga

DBGET integrated database retrieval system