KEGG   Encephalitozoon intestinalis: Eint_050290Help
Entry
Eint_050290       CDS       T02238                                 

Definition
acetylcoenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ein  Encephalitozoon intestinalis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ein00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Eint_050290
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Eint_050290
   00620 Pyruvate metabolism
    Eint_050290
   00640 Propanoate metabolism
    Eint_050290
  Energy metabolism
   00680 Methane metabolism
    Eint_050290
Enzymes [BR:ein01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Eint_050290
Lipid biosynthesis proteins [BR:ein01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Eint_050290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:40030..41928
Genome map
AA seq 632 aa AA seqDB search
MNKGEYEALYKRSIEDKESFWEEQAKAFLKWDKMFDKVYNNNFESSRWFEGGMLNACYNC
VDRHAACNPDKVAIIYDRNDGESICYTFKEVLDEVIRISAVLKAEGLKKGDTVALYMAMS
PYAVFSALACARLGLVHNAIFGGFSASSVALRLDDSNAKFLMVQDVVERHSSTINFLGNV
REALKGRSIPVLVFNTLQDEKKILDELNGVEGKILIWSKVMKRENEFIPCVPVGAEDSLF
YLYTSGSTGIPKGIVHTVGGYLVYAALTSKTCFDLRKEDVFACTADIGWITGHTYVIYGP
LLNGVTTVVFGGTPFYPSYFRLFKMVEKHKITQLYTAPTVIRTLRKYFSTNPLDHGCDLS
SLRILGSVGEPINKNAYLWFKENFNKCSIVDTYWQTESGGILIAPIPYVVDGKPECACLP
FLGQEVVIAGKDSKEDHVIEAKPYELGRVLLRRSWPGIARGILGDLERFKRVYFFYKGFY
FTGDEGYKDADGHVWIRGRADDVINVSGHRISTAEVESAACMDPYIAEAAAVAENDEITG
QALCFFVVLKDKETPQDKVKASLKETLRNKVGKFVNPKDVYFCEGIPKTATGKIMRRVLK
NILAGDSLGDMSTCTNVDVIEGLKDLVSPKAN
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaggagaatatgaagcattatacaagagatctattgaagacaaggaaagtttt
tgggaagagcaggccaaggccttcttgaaatgggacaaaatgtttgataaggtttataac
aataattttgagagctccagatggtttgagggagggatgctaaatgcgtgctataattgt
gtggatagacacgcagcttgtaatcccgacaaagttgcaattatttatgataggaatgac
ggagagtcgatttgctatacatttaaagaggtgcttgacgaggtcataagaatttcggct
gtgcttaaagcagaaggccttaaaaaaggagacactgttgctttgtatatggcaatgtct
ccttatgctgtgttttctgcacttgcatgtgcaagacttggccttgttcataatgccatt
tttggaggctttagtgcaagtagcgtggctctgcggcttgacgactcaaacgccaagttc
ttgatggtccaggatgttgttgagagacacagctcgaccataaacttccttgggaatgta
agggaagcccttaagggaagatccattcctgttttggttttcaatactcttcaggatgaa
aagaagatactggacgaactgaacggagttgaaggtaagattttaatctggtcaaaggtc
atgaagagggaaaacgaatttattccctgtgtgcctgtcggagccgaggatagtcttttc
tatctgtacacaagtggaagtacaggaattccaaaggggattgtgcatacggtaggagga
tacctagtgtatgcagctcttacttccaagacatgttttgaccttcgaaaagaagatgtt
tttgcttgcacagcagacataggatggattacaggccatacatatgtaatttatggcccg
ctgttgaatggggtcacaacagttgtgtttggggggacgccgttctatccttcgtacttc
agacttttcaaaatggttgaaaaacacaagataacacagctgtatacagctccaactgta
atcaggacattaaggaagtatttttcgacgaatccgctggatcatgggtgcgatctgtct
tcattacgaattcttggttctgtcggagagcctataaacaagaatgcttacctatggttt
aaggaaaactttaacaagtgctccattgtcgatacttattggcaaactgaatctggaggg
attctgattgctcctattccatatgttgttgacggaaagcctgaatgtgcatgccttcca
tttttgggccaggaagttgttattgcaggcaaggattcgaaagaggatcatgttattgaa
gcaaaaccttatgagcttgggcgtgttcttttaagaagatcttggccaggaatcgctaga
ggaattctaggagatctagagaggttcaaaagagtatacttcttctataaggggttttac
tttactggagatgagggatacaaagatgctgatgggcacgtatggataaggggaagggca
gacgatgtgataaatgtctcgggacatcggatcagcacagcagaggttgagagtgcagca
tgcatggatccctacatagccgaggcagcagctgttgccgaaaacgatgaaatcaccggc
caggcgctttgttttttcgtagttttgaaggataaggaaacaccacaggataaagtaaaa
gcgtctctgaaggaaactctgcgaaacaaggtcggaaagtttgttaatcccaaggacgtt
tacttctgcgaggggattcctaagactgcgactggaaagatcatgagaagggttttgaaa
aatatcttggctggagactcacttggagatatgtcgacctgcaccaatgtagatgttatc
gagggtttgaaagatctcgtctctccaaaggcaaattaa

DBGET integrated database retrieval system