KEGG   Encephalitozoon intestinalis: Eint_051300Help
Entry
Eint_051300       CDS       T02238                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
ein  Encephalitozoon intestinalis
Brite
Enzymes [BR:ein01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Eint_051300
Peptidases [BR:ein01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Eint_051300
Transcription machinery [BR:ein03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Eint_051300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:complement(161345..162547)
Genome map
AA seq 400 aa AA seqDB search
MNLCIHVESLKNVEKILKAITLKLGHLKKKGLSTRCNAGKTSIDLQICLQCYCLLCSTDK
GLHSHEVFLDPTSSVISCAVCARRYFLRSLTNRIEDTVIVSISSSLYEVFPYIPLKGFSN
LGNTCYINAVLSIMINLCPIRDELLSNTHTRFKCRDSRCIMCAMKSLIDYSYGSECVLTH
KFIHTMWLLVPHFVGSMQQDVHEFFVCLLQKIHEAYDFQSTDEITCKCLSHRTFFGMFSS
TMLCRNCNLKKTKEEAFATIPLECLPSIQSSLDIFLGTEDLKDEVMCEACQEEGLCTKRL
EVKRYPRVLSLHLKRFSYEGVSRKIDSHVALSNTLAVGERIYDVLGFISHRGSITYGHYL
SYAIFGGKWYRMDDERVEVIPYEKVSTEGLYLAYYLLRGK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatgtatacatgttgaatcactaaagaatgttgaaaagatcctcaaggcgatt
actttaaaactgggccatctcaaaaagaagggattgagtacccggtgcaatgccggcaag
acttcaatagacctacaaatatgcctacaatgctactgtctcctttgtagcacagacaag
ggattgcatagccatgaagtatttcttgatcctacttcttctgttatctcttgtgctgta
tgtgctaggaggtatttcttgagaagcctcaccaacagaatagaagacacagtcatagtt
agtatctcttcatcactgtatgaagtttttccatacatccccctcaaagggttttcaaac
cttggaaatacgtgctatataaacgcagttcttagtataatgatcaatctatgtccaata
agagacgaacttttgtcaaatacacatacaaggttcaagtgtagagacagcaggtgtata
atgtgtgccatgaagtctctaattgactattcatatggctctgagtgtgtgcttacgcac
aagttcatacacacaatgtggcttctggttcctcactttgtaggatctatgcagcaggat
gtgcatgaattctttgtatgccttctccaaaagattcacgaggcatatgacttccagtct
acagacgagatcacctgtaaatgcttatctcatcgaacattcttcgggatgttttcctcg
acaatgctgtgtagaaactgtaatcttaagaaaacaaaagaagaagcatttgcaacaatt
cctcttgaatgccttccttctatccagtcatcgttggacatcttccttggaaccgaggac
ttgaaggatgaggtaatgtgtgaagcttgccaggaagaagggttatgcacaaaaaggttg
gaagtcaaaagatatccaagggtcttatctcttcatctaaagagattctcctatgaagga
gtgtccagaaaaatcgattcccatgtagccttatcaaatacattagccgtgggagaaagg
atctatgatgttttagggtttataagccatcgtggatccattacttatggccattatctt
tcctatgccatatttggaggcaagtggtataggatggatgacgaaagggtagaggtgatt
ccctatgaaaaggtatccactgaaggcctgtaccttgcttattatctcctccgaggaaag
tag

DBGET integrated database retrieval system