KEGG   Encephalitozoon intestinalis: Eint_060270Help
Entry
Eint_060270       CDS       T02238                                 

Definition
replication factor A protein 2
Orthology
K10739  
replication factor A2
Organism
ein  Encephalitozoon intestinalis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ein00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Eint_060270
   03420 Nucleotide excision repair
    Eint_060270
   03430 Mismatch repair
    Eint_060270
   03440 Homologous recombination
    Eint_060270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:complement(37339..38019)
Genome map
AA seq 226 aa AA seqDB search
MDRSDGGYIQSSPKREFLGIKTLRTLTIKQINNCDFDEASSTHMIDSAEVTNVQIVGWVV
SSRTSATGSMFVLEDGTESVDCTFWPSNSYEEEQCKALEEHGLLQVNGSLRTFNGKRSVS
VSHLAQVEDPNLITYHFLNCIYQHLFYTRQLQREEVKSDGAKLGRIQEDILECYRKNQDE
NGLHINVVIKMLSSKYPESEIKENIDVLLRDCHLYSVDGLEYKTTV
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggacagaagtgacggaggatacatccaaagctctccaaaaagagaattcctaggaata
aagacactaagaacactcacaatcaaacagatcaacaactgtgactttgatgaggcatct
tcaacacacatgatcgactctgcggaagtcaccaacgttcaaattgttggatgggttgta
tcttcgagaacatcggcaacaggttcgatgtttgttttggaggatgggacagagagtgtg
gattgtacattctggccaagtaattcctatgaggaagagcagtgcaaggctcttgaagaa
catggacttctccaggtcaatgggtctctccgaacattcaatggaaagagaagtgtatct
gtgtcccatctagcccaggtagaagacccaaatcttatcacctaccactttctgaactgt
atctatcaacatctattctataccaggcagcttcagagagaagaggtaaaaagcgatggt
gcaaagctcggcaggatccaggaggacatactggagtgctataggaagaaccaggatgag
aatgggcttcacataaatgtggttatcaagatgctctcgtctaaatatccagaaagcgag
attaaagaaaacatcgatgttctattgagggattgccatctttacagtgtggatggtttg
gaatacaagacaacagtttaa

DBGET integrated database retrieval system