KEGG   Encephalitozoon intestinalis: Eint_060840Help
Entry
Eint_060840       CDS       T02238                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase
Organism
ein  Encephalitozoon intestinalis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
VI:111674..113821
Genome map
AA seq 715 aa AA seqDB search
MKAEESRGQSPVSDQGLWEYAVSSIFTGAQRKFREALVIPGLRPPGPRIHFVPKDVWKAI
KEDLSTECNPCYEYREEPWRAVFVTFVIDELVPNTNAPETGRSMVVKVGWILSILQSLVS
LNDFRSYERPCRTGGMGKSRKIVNVLSSSTDRVFDVVLEIMGFEVGLDEFMSLYRIMALD
GRVIHPLVKLEGFGDGSVLRISRIVRMPDGRALSADSHMKNIARGLKNQGNTCFMNSGLQ
CLTNCWKLTEYFMSKEYEKHLDETKPIHVSLANAYYDLISEMYNGDQQSIVPSGIRASLG
SVYEEYKGNEEQDAAEFIGKTLDMLHEGLSKGYGDSEKKESWKRSIVTDLFFFSQKSTLT
CKECGRSKTSVEPSMCLSLPIPYQREYKENIVLFYESGRRQPLRTYADVSSSIGDLKRIL
RADYDVAGKVTCIWYGAGRRMFELGDDVILKDVPQTLFCYEYFEDKKYCWVHLKTKKLFI
DRSFKFNILIRAFGSNESLIFLEMKKTIAHLVEREAQCILEREDISPYFKLEIAAWDYGE
KTIDSPVVVAISRSHGGKRLFGASWNPLDTIRAIDAPSITLQHCLDKFLEKEDLHPSELL
HCEGCGRKRRFSKKMDLECLPVYLIVQLKRFQYVNSFPVKISTLVGYSLDRFSICGTEYK
VIGVCNHDSDTVTSSGHYVSYLRKDGWYLCNDQKIEKVSKIDQEYTYVLFLERCV
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgaggaatctcggggccaaagccctgtctcagaccaagggttatgggaatat
gcagtttcttccatcttcaccggagctcaaaggaagtttagagaagcattggtcatccca
ggccttcggcctccgggacctaggattcattttgtacccaaggatgtctggaaggccata
aaggaggatctttccacggaatgcaacccttgctacgagtatcgggaagagccttggaga
gcagtttttgttacgtttgtgatagatgagcttgtccctaacaccaatgccccagagacc
ggaagaagcatggttgtcaaggttggatggatactttccatactccagtctcttgttagc
ctcaacgactttaggtcttacgaacggccttgccgtacaggaggaatggggaagtctaga
aagatagtaaatgtcctctccagttcgacagatagagtgtttgatgtggtgctggaaata
atgggcttcgaggttgggctggacgagtttatgagcctgtacagaattatggcgctggac
gggagggtgatccatcccttagtgaaacttgaaggctttggagatggaagtgtactccgg
atctcaaggattgtaaggatgcctgacggaagggctctgtctgccgacagccacatgaag
aacatagcccggggacttaagaatcaagggaatacgtgttttatgaatagcgggcttcaa
tgcctgacaaattgctggaagctcacggagtatttcatgagcaaggagtatgaaaaacat
ttggacgagacaaagcctattcatgtatctctggccaatgcatactatgatcttatctcg
gagatgtacaatggagatcaacagtccattgtgccatctgggatccgtgcaagcctggga
tcggtttatgaggaatacaagggaaatgaagagcaggatgcagcggaatttatcggaaag
acactagacatgcttcatgagggtctttcaaagggatatggggacagcgagaagaaagaa
agctggaagcggtcgattgtcaccgacctgtttttcttctctcagaaatcgacgttgaca
tgcaaggagtgcggaagaagcaagacatctgtcgagccctcgatgtgtctttctttgcct
attccataccaaagggaatacaaagagaacattgtgttgttctatgagtctggcaggaga
cagcctttaagaacgtatgcagacgtgtcttccagcattggagatcttaagaggatactg
agagcagactatgatgtggctggaaaggttacgtgcatatggtatggcgcaggacggagg
atgtttgaacttggagatgacgttattctgaaggatgttccgcagaccttgttctgctac
gagtactttgaggataagaaatactgctgggtccatctgaagactaagaaactgtttata
gacaggtcatttaagttcaacatattgatccgagcctttggaagtaatgaatcgctaata
ttcttggagatgaagaagacgatagcccatcttgttgaaagggaagcacagtgcattctg
gaacgggaggacatttccccatacttcaagctagaaatagcggcgtgggattatggggag
aaaacaatcgactctcctgttgtggtggcgataagtagatcccacggggggaaaaggctg
tttggggcttcctggaaccctctggacacgattcgggcgatagatgcaccatccattacc
cttcaacactgcttagacaagtttctggagaaggaagatcttcatccctcggagctctta
cattgcgaggggtgtggcagaaagagaaggttcagtaagaagatggacttggagtgtctc
cctgtgtatctgatagtccagctgaagaggttccagtatgtcaactcctttcccgtaaag
atctcaactctggttggatattccctggatagattttccatttgtggaacggaatacaaa
gtcataggagtgtgcaaccatgactcggatacagtcacatctagtggacattatgtaagc
tatcttcgaaaggacggatggtacctttgcaacgaccagaagattgagaaggtctcgaaa
atagaccaggaatacacatatgttctctttcttgaaagatgtgtctag

DBGET integrated database retrieval system