KEGG   Encephalitozoon intestinalis: Eint_060840Help
Entry
Eint_060840       CDS       T02238                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase
  KO
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
ein  Encephalitozoon intestinalis
Brite
Enzymes [BR:ein01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Eint_060840
Peptidases [BR:ein01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Eint_060840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:111674..113821
Genome map
AA seq 715 aa AA seqDB search
MKAEESRGQSPVSDQGLWEYAVSSIFTGAQRKFREALVIPGLRPPGPRIHFVPKDVWKAI
KEDLSTECNPCYEYREEPWRAVFVTFVIDELVPNTNAPETGRSMVVKVGWILSILQSLVS
LNDFRSYERPCRTGGMGKSRKIVNVLSSSTDRVFDVVLEIMGFEVGLDEFMSLYRIMALD
GRVIHPLVKLEGFGDGSVLRISRIVRMPDGRALSADSHMKNIARGLKNQGNTCFMNSGLQ
CLTNCWKLTEYFMSKEYEKHLDETKPIHVSLANAYYDLISEMYNGDQQSIVPSGIRASLG
SVYEEYKGNEEQDAAEFIGKTLDMLHEGLSKGYGDSEKKESWKRSIVTDLFFFSQKSTLT
CKECGRSKTSVEPSMCLSLPIPYQREYKENIVLFYESGRRQPLRTYADVSSSIGDLKRIL
RADYDVAGKVTCIWYGAGRRMFELGDDVILKDVPQTLFCYEYFEDKKYCWVHLKTKKLFI
DRSFKFNILIRAFGSNESLIFLEMKKTIAHLVEREAQCILEREDISPYFKLEIAAWDYGE
KTIDSPVVVAISRSHGGKRLFGASWNPLDTIRAIDAPSITLQHCLDKFLEKEDLHPSELL
HCEGCGRKRRFSKKMDLECLPVYLIVQLKRFQYVNSFPVKISTLVGYSLDRFSICGTEYK
VIGVCNHDSDTVTSSGHYVSYLRKDGWYLCNDQKIEKVSKIDQEYTYVLFLERCV
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgaggaatctcggggccaaagccctgtctcagaccaagggttatgggaatat
gcagtttcttccatcttcaccggagctcaaaggaagtttagagaagcattggtcatccca
ggccttcggcctccgggacctaggattcattttgtacccaaggatgtctggaaggccata
aaggaggatctttccacggaatgcaacccttgctacgagtatcgggaagagccttggaga
gcagtttttgttacgtttgtgatagatgagcttgtccctaacaccaatgccccagagacc
ggaagaagcatggttgtcaaggttggatggatactttccatactccagtctcttgttagc
ctcaacgactttaggtcttacgaacggccttgccgtacaggaggaatggggaagtctaga
aagatagtaaatgtcctctccagttcgacagatagagtgtttgatgtggtgctggaaata
atgggcttcgaggttgggctggacgagtttatgagcctgtacagaattatggcgctggac
gggagggtgatccatcccttagtgaaacttgaaggctttggagatggaagtgtactccgg
atctcaaggattgtaaggatgcctgacggaagggctctgtctgccgacagccacatgaag
aacatagcccggggacttaagaatcaagggaatacgtgttttatgaatagcgggcttcaa
tgcctgacaaattgctggaagctcacggagtatttcatgagcaaggagtatgaaaaacat
ttggacgagacaaagcctattcatgtatctctggccaatgcatactatgatcttatctcg
gagatgtacaatggagatcaacagtccattgtgccatctgggatccgtgcaagcctggga
tcggtttatgaggaatacaagggaaatgaagagcaggatgcagcggaatttatcggaaag
acactagacatgcttcatgagggtctttcaaagggatatggggacagcgagaagaaagaa
agctggaagcggtcgattgtcaccgacctgtttttcttctctcagaaatcgacgttgaca
tgcaaggagtgcggaagaagcaagacatctgtcgagccctcgatgtgtctttctttgcct
attccataccaaagggaatacaaagagaacattgtgttgttctatgagtctggcaggaga
cagcctttaagaacgtatgcagacgtgtcttccagcattggagatcttaagaggatactg
agagcagactatgatgtggctggaaaggttacgtgcatatggtatggcgcaggacggagg
atgtttgaacttggagatgacgttattctgaaggatgttccgcagaccttgttctgctac
gagtactttgaggataagaaatactgctgggtccatctgaagactaagaaactgtttata
gacaggtcatttaagttcaacatattgatccgagcctttggaagtaatgaatcgctaata
ttcttggagatgaagaagacgatagcccatcttgttgaaagggaagcacagtgcattctg
gaacgggaggacatttccccatacttcaagctagaaatagcggcgtgggattatggggag
aaaacaatcgactctcctgttgtggtggcgataagtagatcccacggggggaaaaggctg
tttggggcttcctggaaccctctggacacgattcgggcgatagatgcaccatccattacc
cttcaacactgcttagacaagtttctggagaaggaagatcttcatccctcggagctctta
cattgcgaggggtgtggcagaaagagaaggttcagtaagaagatggacttggagtgtctc
cctgtgtatctgatagtccagctgaagaggttccagtatgtcaactcctttcccgtaaag
atctcaactctggttggatattccctggatagattttccatttgtggaacggaatacaaa
gtcataggagtgtgcaaccatgactcggatacagtcacatctagtggacattatgtaagc
tatcttcgaaaggacggatggtacctttgcaacgaccagaagattgagaaggtctcgaaa
atagaccaggaatacacatatgttctctttcttgaaagatgtgtctag

DBGET integrated database retrieval system