KEGG   Encephalitozoon intestinalis: Eint_061520Help
Entry
Eint_061520       CDS       T02238                                 

Definition
WD40 domain-containing protein
Orthology
K14298  
mRNA export factor
Organism
ein  Encephalitozoon intestinalis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ein00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Eint_061520
Messenger RNA biogenesis [BR:ein03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Eint_061520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:complement(187828..188784)
Genome map
AA seq 318 aa AA seqDB search
MAQYSAKISDIPNPPSDTVSEIAFSQMHGLMAASSWDGTIRTYDLENLYSPNSSVVSLNK
PLLTCCFSKETPSLAFAGAADGSLQMVDLQTNQVSSFQAHDEGVKSVRCFSNMLITGSWD
KTVKFWDVRSSKLVVSLDLPGKVYAMDLEKELLSMSLSRNEVITYNLNNINQKKPHVSKL
NWMIRSIACAQDNETFAVGGIEGKAEIFNVNSPVKKMIFRCHRVDNKVYAVNSVSFLPTN
HNILVTAGSDGTIVFFDSQARTKMFTQTESQPITYGRFNTNGSYYVYATGNDWSTGYVTT
YRPTQLKAIQVSTTGVKV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtacagcgctaagatttcggacattcccaatcctccgtccgatacagtttcg
gagattgcatttagccagatgcatggcttgatggcagcatccagttgggatggtacaatt
cggacatatgacctggaaaatctatacagtccaaacagcagtgttgtgagtttgaacaag
cctcttcttacatgttgcttcagcaaagagactccttcattggcttttgcaggtgctgct
gacggaagcttacaaatggtggacctccagactaaccaggtctcatcctttcaagcacac
gacgaaggagtcaagtctgtaagatgcttttcaaacatgttgattacaggctcatgggat
aagacagttaagttctgggacgtcaggtcgtccaagcttgtggtttctctagaccttcca
ggaaaggtttatgccatggatcttgagaaagaattactttcaatgtctctttcacgaaac
gaagtgattacatacaatctgaacaacataaaccaaaagaaacctcatgtctcaaaacta
aattggatgattaggtctatagcctgtgcccaggacaacgaaacctttgcagttggagga
atagaaggaaaggcagaaatattcaacgtcaattctcctgtgaagaagatgatctttaga
tgccacagagttgacaataaggtctatgctgtcaactctgtatcatttcttccaactaac
cataacatacttgttaccgcaggaagtgatggtaccatcgtattttttgactcgcaggca
aggacaaaaatgtttactcaaacggaaagccagcctataacttatggaagatttaacaca
aacggaagctattatgtctatgccaccggaaatgattggtctacaggatacgtaacgacc
tacagacctacacagcttaaggccattcaggtcagcactactggtgtaaaggtataa

DBGET integrated database retrieval system