KEGG   Encephalitozoon intestinalis: Eint_070300Help
Entry
Eint_070300       CDS       T02238                                 

Definition
Ser/Thr/Tyr protein kinase
Orthology
K08850  
aurora kinase, other [EC:2.7.11.1]
Organism
ein  Encephalitozoon intestinalis
Brite
Enzymes [BR:ein01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Eint_070300
Protein kinases [BR:ein01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   Eint_070300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:complement(39485..40303)
Genome map
AA seq 272 aa AA seqDB search
MVEYWTLDKFEIGRLLGRGKFGQVWLAREKEKGFIVALKIIPIKEIQTAETARQIRREIE
IHSNLKHPNILRMYGHFHDKDNIYLILEYAGKGEFFKFLSEKGGKFGEKEASLYIRQVIL
ALMYMKECNVIHRDIKPENLLLGSDNLLKIGDFGWAVYNADKRRMTFCGTMEYLAPEMVN
NSIHDSGIDLWCLGILTYEFLIGKTPFESKNRNMREAYKKINSLKYSIPETISSNASDFI
SKLLMLNPSDRMRLAEALNHPFIVKHHGRPDD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggtagaatattggactctggataagtttgaaataggaaggttacttgggcgtggaaag
ttcgggcaggtgtggcttgcaagagagaaagaaaaagggtttatagttgctttgaaaatc
attccaattaaggagatccaaacggctgagacagcaaggcaaatccggagagaaatagaa
atacattccaatctgaagcatccgaacatccttaggatgtatggacacttccacgacaag
gataacatatacctgatattagagtatgcaggaaagggggagttcttcaagttcctgagc
gagaagggaggcaagtttggagagaaagaggcctccctatacataagacaggtgatactg
gctctgatgtacatgaaggaatgcaatgtgatacacagagacataaagccagagaactta
cttcttggatcggataacctcctcaagataggagactttggatgggcggtctacaatgcc
gataagaggagaatgaccttctgcggtacaatggagtatcttgcgccagaaatggtcaac
aacagcatacacgactctggaatagacttgtggtgcttgggaatcttaacatacgagttc
ctcatagggaaaacaccatttgaaagcaagaacaggaacatgagagaggcttacaagaaa
atcaactcattgaaatactcgattccagaaacaatcagctccaatgcctcggactttatc
tctaagcttcttatgttaaatcccagtgacagaatgaggcttgccgaagctttaaatcat
ccatttattgtaaagcatcatggaaggccagacgattga

DBGET integrated database retrieval system