KEGG   Encephalitozoon intestinalis: Eint_070460Help
Entry
Eint_070460       CDS       T02238                                 

Definition
(RefSeq) cAMP-dependent Ser/Thr protein kinase subunit alpha
Organism
ein  Encephalitozoon intestinalis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
VII:60255..61229
Genome map
AA seq 324 aa AA seqDB search
MLKIQDFDFVKVVGEGAFGKVYLVRPKRNPMLIFAMKILDFGEILKQRLADQLENEISIL
KRLYGCPFVAKLYSTDFHRGKVGLTLEYVGGGELFYWLKKCGRFDEKMTRFYAAEIVLAL
KFIHGKGILYRDLKPENILITSTGHIKLIDFGFAVYENESIYMISGTPEYMSPEKLRSED
DGRASDYWGLGIIIYEMLCGDPPFYDASADTIYHKILECQIVFPHYVSPVARSLISGLLD
KSRTTRLGAKGIFEIMNHPFFKGLDWGEIEDRTVTPPFIPSPSSVLGFSGSSSEYSSIDY
GETAVFKPYKYVKHFRKDKIPKRI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagattcaagactttgactttgtaaaagtcgtaggagaaggagcctttgggaag
gtgtatctggtgagacctaagagaaatccaatgcttatttttgcaatgaagatacttgac
tttggggaaatccttaagcagaggttagctgaccagctcgaaaacgaaatttctattttg
aaaagactttatggatgtccatttgttgcaaagctgtattcaacagacttccatcgtgga
aaggtgggactaactctggagtatgttggaggaggcgagctgttttattggctcaaaaag
tgtgggagatttgatgagaagatgactcgattctatgcagcagaaatcgttttggctttg
aagtttatacatggaaaagggattctctacagagacttgaagcccgagaacatactgatt
acgtctacaggacacataaagctgattgactttggatttgcagtctacgaaaacgagagt
atatatatgatttcggggactccggagtacatgtcaccggagaagctgcggagcgaagat
gatggacgtgcaagcgattattgggggctgggaattataatctacgaaatgctatgcgga
gaccctccattctacgatgcaagtgctgacaccatttatcacaagatactcgaatgccag
atcgttttcccccattatgtaagtcctgttgcaagaagcctgatatcaggactattggac
aaaagtcgaaccaccagactaggagccaagggaatattcgaaataatgaatcatcccttt
ttcaagggattggactggggagaaatagaagataggactgtaacaccaccgttcatccca
agcccgagctctgtcctcggattttcaggaagcagctcggaatacagtagcatagattat
ggagaaacagctgtttttaagccatacaagtatgttaaacactttcgaaaggacaagata
ccgaagcggatatag

DBGET integrated database retrieval system