KEGG   Encephalitozoon intestinalis: Eint_070460Help
Entry
Eint_070460       CDS       T02238                                 

Definition
cAMP-dependent Ser/Thr protein kinase subunit alpha
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ein  Encephalitozoon intestinalis
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ein00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    Eint_070460
Enzymes [BR:ein01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Eint_070460
Protein kinases [BR:ein01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Eint_070460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:60255..61229
Genome map
AA seq 324 aa AA seqDB search
MLKIQDFDFVKVVGEGAFGKVYLVRPKRNPMLIFAMKILDFGEILKQRLADQLENEISIL
KRLYGCPFVAKLYSTDFHRGKVGLTLEYVGGGELFYWLKKCGRFDEKMTRFYAAEIVLAL
KFIHGKGILYRDLKPENILITSTGHIKLIDFGFAVYENESIYMISGTPEYMSPEKLRSED
DGRASDYWGLGIIIYEMLCGDPPFYDASADTIYHKILECQIVFPHYVSPVARSLISGLLD
KSRTTRLGAKGIFEIMNHPFFKGLDWGEIEDRTVTPPFIPSPSSVLGFSGSSSEYSSIDY
GETAVFKPYKYVKHFRKDKIPKRI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagattcaagactttgactttgtaaaagtcgtaggagaaggagcctttgggaag
gtgtatctggtgagacctaagagaaatccaatgcttatttttgcaatgaagatacttgac
tttggggaaatccttaagcagaggttagctgaccagctcgaaaacgaaatttctattttg
aaaagactttatggatgtccatttgttgcaaagctgtattcaacagacttccatcgtgga
aaggtgggactaactctggagtatgttggaggaggcgagctgttttattggctcaaaaag
tgtgggagatttgatgagaagatgactcgattctatgcagcagaaatcgttttggctttg
aagtttatacatggaaaagggattctctacagagacttgaagcccgagaacatactgatt
acgtctacaggacacataaagctgattgactttggatttgcagtctacgaaaacgagagt
atatatatgatttcggggactccggagtacatgtcaccggagaagctgcggagcgaagat
gatggacgtgcaagcgattattgggggctgggaattataatctacgaaatgctatgcgga
gaccctccattctacgatgcaagtgctgacaccatttatcacaagatactcgaatgccag
atcgttttcccccattatgtaagtcctgttgcaagaagcctgatatcaggactattggac
aaaagtcgaaccaccagactaggagccaagggaatattcgaaataatgaatcatcccttt
ttcaagggattggactggggagaaatagaagataggactgtaacaccaccgttcatccca
agcccgagctctgtcctcggattttcaggaagcagctcggaatacagtagcatagattat
ggagaaacagctgtttttaagccatacaagtatgttaaacactttcgaaaggacaagata
ccgaagcggatatag

DBGET integrated database retrieval system