KEGG   Encephalitozoon intestinalis: Eint_080080Help
Entry
Eint_080080       CDS       T02238                                 

Definition
Ca2+-binding protein
Organism
ein  Encephalitozoon intestinalis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII:6777..7379
Genome map
AA seq 200 aa AA seqDB search
MGSLSSTMLCEEEIEELKNTTVFDEREIEHLYERFQFLDRESRGYLTYNELNNIPEFQSN
PFSHLIMKSIEKMTDYEKMTFPHFLEFLGIFSEKNNRKNRIRYLFDIFDLNGDGKLCRNV
LVRINKMMGQDGKMEEVENLLNIYDEGGKGYLDTSDFAKFYESDPLIDRNMIIDFSKNLK
RPRQVGFMQVLWPSTYKDEE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgggatctttgagtagcacaatgctgtgcgaggaggaaatagaggagttgaagaacact
acggtttttgatgagagagagatcgaacatttatacgaaaggtttcaatttctagacagg
gagtcccggggatatctaacatataatgagttgaacaacatccctgagttccagtcgaat
cccttcagtcatcttataatgaaaagcattgaaaagatgactgactatgaaaaaatgaca
tttccacacttcctcgaatttttgggaatcttttccgagaagaacaatagaaaaaacagg
ataagatatctgttcgacatctttgacttaaatggagacggcaagctatgcagaaatgta
cttgtcagaattaacaagatgatgggccaagatggaaagatggaggaagtcgaaaatctt
ttaaacatttacgatgaagggggtaagggatacttagatacatcggactttgctaagttt
tatgaaagcgaccctctaatcgataggaatatgataatcgatttctcgaagaatctgaag
cgacccaggcaagtggggtttatgcaagtgttgtggccatcaacctataaggatgaagaa
taa

DBGET integrated database retrieval system