KEGG   Encephalitozoon intestinalis: Eint_080080Help
Entry
Eint_080080       CDS       T02238                                 

Definition
(RefSeq) Ca2+-binding protein
Organism
ein  Encephalitozoon intestinalis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 9698128
NCBI-ProteinID: XP_003073305
UniProt: E0S8F1
Position
VIII:6777..7379
Genome map
AA seq 200 aa AA seqDB search
MGSLSSTMLCEEEIEELKNTTVFDEREIEHLYERFQFLDRESRGYLTYNELNNIPEFQSN
PFSHLIMKSIEKMTDYEKMTFPHFLEFLGIFSEKNNRKNRIRYLFDIFDLNGDGKLCRNV
LVRINKMMGQDGKMEEVENLLNIYDEGGKGYLDTSDFAKFYESDPLIDRNMIIDFSKNLK
RPRQVGFMQVLWPSTYKDEE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgggatctttgagtagcacaatgctgtgcgaggaggaaatagaggagttgaagaacact
acggtttttgatgagagagagatcgaacatttatacgaaaggtttcaatttctagacagg
gagtcccggggatatctaacatataatgagttgaacaacatccctgagttccagtcgaat
cccttcagtcatcttataatgaaaagcattgaaaagatgactgactatgaaaaaatgaca
tttccacacttcctcgaatttttgggaatcttttccgagaagaacaatagaaaaaacagg
ataagatatctgttcgacatctttgacttaaatggagacggcaagctatgcagaaatgta
cttgtcagaattaacaagatgatgggccaagatggaaagatggaggaagtcgaaaatctt
ttaaacatttacgatgaagggggtaagggatacttagatacatcggactttgctaagttt
tatgaaagcgaccctctaatcgataggaatatgataatcgatttctcgaagaatctgaag
cgacccaggcaagtggggtttatgcaagtgttgtggccatcaacctataaggatgaagaa
taa

DBGET integrated database retrieval system