KEGG   Encephalitozoon intestinalis: Eint_080330Help
Entry
Eint_080330       CDS       T02238                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
ein  Encephalitozoon intestinalis
Brite
Exosome [BR:ein04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Eint_080330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII:complement(34233..34628)
Genome map
AA seq 131 aa AA seqDB search
MAKSARHVTGKAPGTSLDGGDKKKSKKKSSSMCVGGMFKSAVKRISREVSPDNNIMLTSN
SIQVLCGISFDFVDTVADLAGELARKVGKQTVGSDDIVSAFEILLKGELRKLAIREVHNA
LSKSQAKSRGK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtccgcaagacatgttacaggtaaggctccaggaacatctttggatggaggc
gacaaaaagaagtctaagaagaagtcatcttccatgtgcgttggaggaatgttcaagtcg
gcagtcaagcgtatttctcgagaggtcagcccggacaacaacatcatgctgacaagcaac
tcaatccaagttctctgcgggatttcttttgactttgttgacacagttgcagaccttgca
ggagagctagcaaggaaggttggcaagcagaccgtgggatccgatgacattgtaagtgcc
tttgagatcttgctcaagggagagttgaggaagctggccataagagaagttcacaatgct
ctttcaaagagccaggccaagtcccgaggaaaataa

DBGET integrated database retrieval system