KEGG   Encephalitozoon intestinalis: Eint_080850Help
Entry
Eint_080850       CDS       T02238                                 

Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
ein  Encephalitozoon intestinalis
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ein00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Eint_080850
Translation factors [BR:ein03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Eint_080850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII:86318..86839
Genome map
AA seq 173 aa AA seqDB search
MNLASQWVLWQNNNDESNAKSWGDDLMVVGEVSTIPEFLYLCDEISNVGVGKLCTMNLFK
KGIKPMWEDEGNIEGGRIIMDVPVVGKDSIDELWKRTMAFCVSNTVDNICGCVLSEKQSF
YKVAIWFGKDYNQDSIKDMWQEALGGGKLSIYSFLHKKSLDSNKGKKKWGGRR
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaacttggcgtcgcagtgggttctttggcagaacaacaacgacgagtcgaatgccaag
agctggggagacgacctcatggttgttggggaggtgtcgacgataccggagttcctgtat
ctctgtgacgagatatcgaatgtcggggttggaaagctgtgcacaatgaatctgtttaag
aaaggaatcaagccgatgtgggaggatgagggaaacatagaaggaggaagaattataatg
gatgttcctgtggtgggcaaggacagtattgatgagctgtggaaaagaaccatggcgttc
tgtgtctcgaataccgtcgataacatatgcgggtgtgtactcagtgaaaaacagtcgttt
tacaaggtggcaatctggtttgggaaagattataaccaggattcgattaaggacatgtgg
caagaagcccttggagggggaaagctatccatctactctttcttgcacaagaagtcgttg
gacagcaacaaaggaaaaaaaaagtggggaggaagaaggtag

DBGET integrated database retrieval system