KEGG   Encephalitozoon intestinalis: Eint_100610Help
Entry
Eint_100610       CDS       T02238                                 

Definition
histone acetyltransferase
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
ein  Encephalitozoon intestinalis
Brite
Enzymes [BR:ein01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Eint_100610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X:complement(76730..77863)
Genome map
AA seq 377 aa AA seqDB search
MKLEDVCIGFKVPVKKIVDGAEEVFKAEVLGTRTTNSRLEFYVHYVELNRRLDEWIDSSM
VDLSDPSQVEIPKKKKSEKTKTEKSRRDSEKEDGGGDEEPKLEKPPQDEEFKMKNVKKIM
LRNYLVDAWYFSPYPKAIAENDVVYICEFCLYYFGTMDSLTQHARQCKLRHPPGREIYRD
GDLSFFECDGHIQKNYCRNLSLLSKLFLDHKSLYYDIDVFMFYVLCRLEDNGYQIVGYFS
KEKVSEQGYNLACILTLPFEQRKGYGRVLIDFSYLLSKRENVISGPEKPLSDLGLLSYRA
YWMEVVVEYLSRHDKASINEISKETHISEDDIVGTLSAYKMLRISGNEFIFTYSEKQLQK
AQRSRDRCVKGSLLKLY
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgaggatgtttgtataggattcaaagttccagtcaagaagattgtggatggg
gccgaagaagtattcaaagcagaggttcttgggacaagaacaaccaactccaggcttgag
ttctatgtccattatgtggagctgaacagaaggcttgatgagtggatagactcgtcgatg
gttgacctcagcgacccttctcaggtggagattcctaagaaaaagaagtcggaaaagaca
aagaccgagaagtcgagaagagactcggaaaaggaggatggaggaggggatgaagagcct
aagctggagaagccgcctcaggatgaagagttcaagatgaagaacgtcaagaagatcatg
cttcggaattatcttgtggatgcatggtatttctcgccatatccaaaggcaatagccgag
aacgacgtggtttacatatgcgagttctgtctttactattttgggacaatggacagcctg
actcagcatgcaaggcaatgcaagcttcgccatcctcccggaagagagatataccgggac
ggagacttaagtttttttgaatgcgacgggcacatacagaaaaactactgtaggaactta
tctctactttcaaagctgtttttggatcacaagtcgctctattacgatatagatgtattt
atgttttatgtgctctgcaggctggaagacaacggataccagatagtgggatacttctca
aaggaaaaggtgtctgagcagggatacaatcttgcatgcatcttgacccttccttttgag
caaagaaagggatatgggagagtcctgatcgacttctcatacctactcagcaaaagagaa
aatgtgatttccgggcctgaaaagcctctgagtgatcttgggcttcttagctacagagca
tattggatggaggttgttgtagagtatctttcaagacacgacaaagcaagcatcaacgag
atatccaaagaaactcacatatctgaggacgacatagtaggtactctttctgcatacaag
atgttgagaataagtggaaacgaatttattttcacatacagcgaaaagcagttgcagaaa
gctcagaggtccagggaccgatgtgtaaaaggatccctgcttaaactgtattaa

DBGET integrated database retrieval system