KEGG   Encephalitozoon intestinalis: Eint_101380Help
Entry
Eint_101380       CDS       T02238                                 

Definition
bromodomain-containing transcriptional activator
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ein  Encephalitozoon intestinalis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X:complement(187414..188622)
Genome map
AA seq 402 aa AA seqDB search
MDSVETNLFGLERNQTWRNEKEMLYAKFKNGELKAVVVSSSDPCVDKILLLRTKYLFQNQ
LSKMPGEYILRQVFDTKHANLVLLNSVGEVVGGICYRPFFERNFVEIVFLAVDYDFQVKG
IGGFMMDLFKEVIKEEIRSYFEKPSNGLSGSPKQKNRVIEDLTPLLCRTPESNAPSLYLV
TYADNFAIGYFKKQGFTTEIRFGGWIGFIKDYEGGTIVECCVLWEINYLKKQEIIQDRKR
KLFEEMKKVNEYHIIRKIDDYSEIKDVNDIPGVLNARYSAEETNDQRCQDRFISYLISDL
CINAYAWPFLKPVDPKEVPNYYKCISKPMDLSTMSSKLKNNEYKFIEAFVEDVNLMVNNC
FTYNGKDTQYYKCAQKLLNHFNRRLEFYKHVVDKLPKKKEIN
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggatagtgttgaaacgaatctttttggattggaaagaaaccaaacatggagaaatgaa
aaagaaatgttgtatgcgaagttcaagaatggggagctgaaggctgttgttgtgtcgtcg
tcggatccatgtgtagacaagatacttcttctgagaaccaagtatcttttccagaatcag
ctctccaagatgcctggggaatacattctcagacaagtattcgacacaaagcatgccaac
ctggtactgctgaactccgtaggagaagtggttggcggaatatgttacagaccgtttttt
gagagaaactttgtagaaattgtgttcttagctgtagactatgatttccaagtaaaagga
attggaggatttatgatggatctctttaaggaggtcattaaggaagagataagaagctat
tttgagaaaccatcaaatggcctttcagggagccctaaacagaagaatagggttatagaa
gatctcaccccgcttctatgcagaactcctgaaagcaatgccccatccctctacttggta
acatatgcagacaactttgcaatagggtacttcaagaaacaaggatttacaacagagata
agatttggaggatggattgggtttattaaggactatgaagggggcacaatagtagagtgc
tgtgtactctgggaaattaactatttgaaaaagcaggagattattcaagataggaaaaga
aagttgtttgaagagatgaagaaggtcaatgaatatcatattattcggaagatagatgac
tactcggaaattaaagacgtcaacgatattccaggagtcttgaatgcaaggtattctgca
gaggagaccaatgatcagaggtgccaggacaggtttatttcgtatcttatatctgatctt
tgcatcaatgcatatgcctggccatttttgaagcctgtggatcctaaggaagtccctaac
tactacaaatgtatatccaaacctatggatctgtctacgatgtcatctaagttaaaaaac
aatgaatacaaattcattgaagcgtttgttgaagacgtgaacttaatggtgaataattgc
tttacatacaatggtaaagacacacaatattataaatgtgcacaaaaactcctgaaccat
ttcaatagaagacttgagttttacaagcatgtggttgacaaacttccgaaaaaaaaagaa
atcaattga

DBGET integrated database retrieval system