KEGG   Encephalitozoon intestinalis: Eint_101560Help
Entry
Eint_101560       CDS       T02238                                 

Definition
choline phosphate cytidylyltransferase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
ein  Encephalitozoon intestinalis
Pathway
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ein00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Eint_101560
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Eint_101560
Enzymes [BR:ein01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Eint_101560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X:complement(204063..204899)
Genome map
AA seq 278 aa AA seqDB search
MMKRNDTEKYKMMAPTYPDRNTFEYEEMTSEVGMYKVPVNRPVRIYCDGVYDLFHYGHAR
SLKQAKNLFPNVYLLVGVTDDDITIRLKGNLVMNEKERAEGLIHCRYVDEVITSAPWELT
SEFLQKHRIDFVAHDDIPYKGENKDDIYKFVKDMGMFIPIKRTKGISTSGIITDIVRNYD
VYVRRNLERGVSAKDLNISFLHMKRIKMSKKMNEMIKNVDIQREIEDIRREIRIAMRYWE
RVSNEIISGFIENFYHGKTSGRFIDRLVEFVKLKRKNE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagagaaacgacacagagaaatacaagatgatggctcccacatatcccgacaga
aataccttcgagtatgaagagatgacctctgaagttgggatgtataaggtccctgtgaat
aggcctgttagaatatactgcgatggggtgtacgatctatttcattatggacatgcccga
agtttgaaacaagcaaagaatctttttccaaatgtctacttgctggttggggttacagat
gacgacataactataagacttaagggaaatcttgtcatgaacgaaaaagaaagagctgaa
ggactaatccattgcagatatgttgatgaagttataacaagtgcaccatgggagttaaca
tcggaattccttcaaaagcatagaatagattttgttgcgcatgatgacattccgtacaag
ggagagaataaggacgatatctacaagtttgtaaaagacatggggatgtttataccgatc
aaaagaacaaagggaattagtactagtggaataataacagacatagtgaggaactatgat
gtatatgtccgaagaaaccttgagagaggagtttctgcaaaggacctgaatatatcgttc
cttcatatgaagagaataaagatgagtaagaaaatgaatgagatgatcaagaatgttgac
attcaaagagagattgaagacataaggcgagaaataagaattgcaatgaggtactgggaa
agagtgtccaacgagattatttctggatttatagaaaacttttaccatggaaagacttct
ggcaggtttattgatcgcctagtggagtttgtgaagcttaagagaaagaatgaataa

DBGET integrated database retrieval system