KEGG   Encephalitozoon intestinalis: Eint_101560Help
Entry
Eint_101560       CDS       T02238                                 

Definition
choline phosphate cytidylyltransferase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
ein  Encephalitozoon intestinalis
Pathway
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ein00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X:complement(204063..204899)
Genome map
AA seq 278 aa AA seqDB search
MMKRNDTEKYKMMAPTYPDRNTFEYEEMTSEVGMYKVPVNRPVRIYCDGVYDLFHYGHAR
SLKQAKNLFPNVYLLVGVTDDDITIRLKGNLVMNEKERAEGLIHCRYVDEVITSAPWELT
SEFLQKHRIDFVAHDDIPYKGENKDDIYKFVKDMGMFIPIKRTKGISTSGIITDIVRNYD
VYVRRNLERGVSAKDLNISFLHMKRIKMSKKMNEMIKNVDIQREIEDIRREIRIAMRYWE
RVSNEIISGFIENFYHGKTSGRFIDRLVEFVKLKRKNE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagagaaacgacacagagaaatacaagatgatggctcccacatatcccgacaga
aataccttcgagtatgaagagatgacctctgaagttgggatgtataaggtccctgtgaat
aggcctgttagaatatactgcgatggggtgtacgatctatttcattatggacatgcccga
agtttgaaacaagcaaagaatctttttccaaatgtctacttgctggttggggttacagat
gacgacataactataagacttaagggaaatcttgtcatgaacgaaaaagaaagagctgaa
ggactaatccattgcagatatgttgatgaagttataacaagtgcaccatgggagttaaca
tcggaattccttcaaaagcatagaatagattttgttgcgcatgatgacattccgtacaag
ggagagaataaggacgatatctacaagtttgtaaaagacatggggatgtttataccgatc
aaaagaacaaagggaattagtactagtggaataataacagacatagtgaggaactatgat
gtatatgtccgaagaaaccttgagagaggagtttctgcaaaggacctgaatatatcgttc
cttcatatgaagagaataaagatgagtaagaaaatgaatgagatgatcaagaatgttgac
attcaaagagagattgaagacataaggcgagaaataagaattgcaatgaggtactgggaa
agagtgtccaacgagattatttctggatttatagaaaacttttaccatggaaagacttct
ggcaggtttattgatcgcctagtggagtttgtgaagcttaagagaaagaatgaataa

DBGET integrated database retrieval system