KEGG   Encephalitozoon intestinalis: Eint_110050Help
Entry
Eint_110050       CDS       T02238                                 

Definition
(RefSeq) Ser/Thr protein kinase
  KO
K18670  dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
ein  Encephalitozoon intestinalis
Brite
Enzymes [BR:ein01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Eint_110050
Protein kinases [BR:ein01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   Eint_110050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RIO1 Kdo APH Choline_kinase ABC1
Motif
Other DBs
NCBI-GeneID: 9699573
NCBI-ProteinID: XP_003073867
UniProt: E0SA80
Position
XI:complement(5481..6698)
Genome map
AA seq 405 aa AA seqDB search
MNKKVLTFPSEKVGLSSDNVEFDLVMSRGDYLSKNKAQRYMVIDMLGTGTFGQVVRCVGP
EGEEVAIKVVKNQPKYYNYEMNEVRILHKLLYNNLNDRFVSIKDVFMYKQHLCIVEELLG
KNLYTFLKMTRFKGFDHITLRTILQQVLEGMIQLSMLGIIHCDLKPENILIADYETFKIK
IIDFGSAVTSPQGSHFYVQSRYYRAPEVILGIPYGSSCDIWSLGCIGYELYVGHPLFPGK
DNMDQMGRIYGLFGSLPMFMIEHGKNSNIFFEKENGYRFIGPASNFTLEDMKKIIRSKCN
SQDDDDMLIEFLLKALQPSHLIRPDARSLANHSYLKLKDVSPELNKIHDSRNGVQQSILP
ASKNMRHMSTTGIILPSKKQKSTNDRRKISVYGISYENNLNRDAE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaagttttgacctttccatctgaaaaggtaggcctctcctcagacaatgta
gagtttgatcttgtaatgtctcgaggagattatttgtcgaaaaacaaagcccagagatat
atggtcatagatatgctgggaactggaacttttggacaggttgttaggtgcgtaggacct
gaaggtgaagaagttgctatcaaggtggtcaaaaatcagccgaaatactacaactacgaa
atgaacgaggtccgaattctccacaaactgctttataataacctaaacgatagatttgtt
tcgattaaggatgtcttcatgtataaacaacatttgtgtattgtagaggagttacttggc
aaaaacctatatacatttttaaaaatgacaagattcaagggctttgaccatatcaccctt
agaactatacttcagcaagtacttgaagggatgatccagctctcaatgctagggatcatt
cattgtgacttgaagccagaaaacatcctcatagccgattacgaaaccttcaagataaag
attatcgattttggatctgcagtaacctccccccaaggatcgcacttctatgtccaatca
agatattaccgggctcctgaagtgattcttgggattccatatggatcaagctgcgatata
tggtccctaggttgcataggatatgaactgtatgttggacatccattgtttccaggaaaa
gataacatggaccaaatgggaagaatctatggtctttttggctccttacctatgtttatg
atagagcatgggaaaaattcaaacatcttttttgaaaaggaaaacggatacagatttata
gggccagcatctaactttacactagaagacatgaagaagattatcaggtcaaaatgtaac
tcccaagacgacgatgatatgcttatagagtttctgctaaaggcacttcaacccagccat
cttataaggccagacgccaggtcattagcaaatcattcttatctcaagctcaaggatgtg
tctccagaacttaataagattcatgacagccgaaatggagtacaacagagtattctcccc
gcaagtaagaacatgagacatatgtctaccacgggaataatccttcctagtaaaaagcag
aaatctacaaatgacagaagaaaaatatctgtttacggaatttcatatgaaaacaattta
aacagagatgcagaatga

DBGET integrated database retrieval system