KEGG   Encephalitozoon intestinalis: Eint_111240Help
Entry
Eint_111240       CDS       T02238                                 

Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
ein  Encephalitozoon intestinalis
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:ein03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
XI:145514..146047
Genome map
AA seq 177 aa AA seqDB search
MNKLPSRFHVTLKVLENSGNEISKDTYEKDLKSICTLESQEHVSYLLHHLKDFDKIDKQF
YINVFKEGISPVWEDENNMNGCDWSLMLKKEVCQRYFERLLVNLCTGYFKTFEPTGIVGI
HKDNRFKLSIWSKNIPSTADCGAIINELKAALEIDFVITFHYKNHSKILAYHKSLDA
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaataagcttccatcaaggttccatgttaccctcaaagtccttgagaattccggcaac
gaaatttccaaagacacctatgagaaggacttgaagagtatatgcaccctggagtcccaa
gaacatgtttcctatctgttgcatcacttgaaagacttcgataaaatagacaagcaattt
tatatcaacgtatttaaagagggaatcagccctgtttgggaagacgagaacaatatgaat
ggatgtgactggagtcttatgcttaagaaagaggtgtgccagagatactttgagagactt
cttgtaaatctatgtacaggctacttcaagacgtttgagcccaccggaattgtagggata
cacaaggacaacagattcaagcttagcatatggtcgaagaacattccatcgacagcagat
tgcggggcaataatcaacgagctgaaggctgcactggagatagattttgtaattacattc
cactacaaaaaccattcgaagatactggcatatcacaaatctcttgatgcatga

DBGET integrated database retrieval system