KEGG   Escherichia coli KO11FL: KO11_01440Help
Entry
KO11_01440        CDS       T02104                                 

Definition
endolysin
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ekf  Escherichia coli KO11FL
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(318522..319037)
Genome map
AA seq 171 aa AA seqDB search
MAGIPKKLKAALLAVTIAGGGVGGYQEMTRQSLIHLENIAYMPYRDIAGVLTVCVGHTGP
DIEMRRYSHAECMALLDSDLKPVYAAIDRLVRVPLTPYQKTALATFIFNTGVTAFSKSTL
LKKLNAGDYAGARDQMARWVFAAGHKWKGLMNRREVEMAIWNIRGADDLRQ
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggcggggataccaaaaaaactgaaagccgcactgctggctgtaacgattgccggtggc
ggagtgggtggttatcaggaaatgacccgtcagtctctgatccacctggaaaatatcgct
tatatgccttaccgcgatattgccggtgtgcttacggtctgtgtgggacataccgggccg
gatatcgaaatgcgccgttacagccatgcggagtgtatggctctcctcgacagtgattta
aaaccggtttatgcggcaatcgatcgtcttgtcagggtgccgctgacgccatatcagaaa
acggcgctggcaacgtttattttcaacaccggtgttaccgcattcagtaaatcaacgctg
ctgaaaaaactcaatgccggtgattacgccggagcgcgtgaccagatggcccgctgggtg
tttgccgcaggccataaatggaaaggactgatgaaccgtcgcgaagtggaaatggcaatc
tggaatatcaggggggcggatgaccttcgccagtaa

DBGET integrated database retrieval system