KEGG   Escherichia coli KO11FL: KO11_01560Help
Entry
KO11_01560        CDS       T02104                                 

Gene name
frdB
Definition
fumarate reductase iron-sulfur subunit (EC:1.3.99.1)
Orthology
K00245  
fumarate reductase iron-sulfur subunit [EC:1.3.99.1]
Organism
ekf  Escherichia coli KO11FL
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Two-component system
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Fumarate reductase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:ekf01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ekf00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ekf00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:ekf00190]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ekf02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
331183..331917
Genome map
AA seq 244 aa AA seqDB search
MAEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRM
AICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPY
IIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRY
NEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIAT
LKPR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggctgagatgaaaaacctgaaaattgaggtggtgcgctataacccggaagtcgatacc
gcaccgcatagcgcattctatgaagtgccttatgacgcaactacctcattactggatgcg
ctgggctacatcaaagacaacctggcaccggacctgagctaccgctggtcctgccgtatg
gcgatttgtggttcctgcggcatgatggttaacaacgtgccaaaactggcatgtaaaacc
ttcctgcgtgattacaccgacggtatgaaggttgaagcgttagctaacttcccgattgaa
cgcgatctggtggtcgatatgacccacttcatcgaaagtctggaagcgatcaaaccgtac
atcatcggcaactcccgcaccgcggatcagggtactaacatccagaccccggcgcagatg
gcgaagtatcaccagttctccggttgcatcaactgtggtttgtgctacgccgcgtgcccg
cagtttggcctgaacccagagttcatcggtccggctgccattacgctggcgcatcgttat
aacgaagatagccgcgaccacggtaagaaggagcgtatggcgcagttgaacagccagaac
ggcgtatggagctgtactttcgtgggctactgctccgaagtctgcccgaaacacgtcgat
ccggctgcggccattcagcagggcaaagtagaaagttcgaaagactttcttatcgcgacc
ctgaaaccacgctaa

DBGET integrated database retrieval system