KEGG   Escherichia coli KO11FL: KO11_01560Help
Entry
KO11_01560        CDS       T02104                                 

Gene name
frdB
Definition
(GenBank) fumarate reductase iron-sulfur subunit (EC:1.3.99.1)
  KO
K00245  
fumarate reductase iron-sulfur subunit [EC:1.3.5.4]
Organism
ekf  Escherichia coli KO11FL
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Two-component system
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Fumarate reductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ekf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KO11_01560 (frdB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KO11_01560 (frdB)
   00620 Pyruvate metabolism
    KO11_01560 (frdB)
   00650 Butanoate metabolism
    KO11_01560 (frdB)
  Energy metabolism
   00190 Oxidative phosphorylation
    KO11_01560 (frdB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KO11_01560 (frdB)
Enzymes [BR:ekf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.4  fumarate reductase (quinol)
     KO11_01560 (frdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
331183..331917
Genome map
AA seq 244 aa AA seqDB search
MAEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRM
AICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPY
IIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRY
NEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIAT
LKPR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggctgagatgaaaaacctgaaaattgaggtggtgcgctataacccggaagtcgatacc
gcaccgcatagcgcattctatgaagtgccttatgacgcaactacctcattactggatgcg
ctgggctacatcaaagacaacctggcaccggacctgagctaccgctggtcctgccgtatg
gcgatttgtggttcctgcggcatgatggttaacaacgtgccaaaactggcatgtaaaacc
ttcctgcgtgattacaccgacggtatgaaggttgaagcgttagctaacttcccgattgaa
cgcgatctggtggtcgatatgacccacttcatcgaaagtctggaagcgatcaaaccgtac
atcatcggcaactcccgcaccgcggatcagggtactaacatccagaccccggcgcagatg
gcgaagtatcaccagttctccggttgcatcaactgtggtttgtgctacgccgcgtgcccg
cagtttggcctgaacccagagttcatcggtccggctgccattacgctggcgcatcgttat
aacgaagatagccgcgaccacggtaagaaggagcgtatggcgcagttgaacagccagaac
ggcgtatggagctgtactttcgtgggctactgctccgaagtctgcccgaaacacgtcgat
ccggctgcggccattcagcagggcaaagtagaaagttcgaaagactttcttatcgcgacc
ctgaaaccacgctaa

DBGET integrated database retrieval system