KEGG   Escherichia coli KO11FL: KO11_04120Help
Entry
KO11_04120        CDS       T02104                                 

Gene name
pldA
Definition
(GenBank) phospholipase A
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
ekf  Escherichia coli KO11FL
Pathway
ekf00564  Glycerophospholipid metabolism
ekf00565  Ether lipid metabolism
ekf00590  Arachidonic acid metabolism
ekf00592  alpha-Linolenic acid metabolism
ekf01100  Metabolic pathways
ekf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ekf00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    KO11_04120 (pldA)
   00565 Ether lipid metabolism
    KO11_04120 (pldA)
   00590 Arachidonic acid metabolism
    KO11_04120 (pldA)
   00591 Linoleic acid metabolism
    KO11_04120 (pldA)
   00592 alpha-Linolenic acid metabolism
    KO11_04120 (pldA)
Enzymes [BR:ekf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     KO11_04120 (pldA)
    3.1.1.32  phospholipase A1
     KO11_04120 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: AFH15810
Structure
PDB: 

Jmol
Position
876107..876976
Genome map
AA seq 289 aa AA seqDB search
MRTLQGWLLPVFMLPMAVYAQEATVKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYL
IYTQTSDLNKEAIASYDWAENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQL
SNSEESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYT
RLMAENGNWLVEVKPWYVVGNTDDNPDITKYMGYYQLKIGYHLGDAVLSAKGQYNWNTGY
GGAELGLSYPITKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDLF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcggactctgcagggctggttgttgccggtgtttatgttgcctatggcagtatatgca
caagaggcaacggtgaaagaggtgcatgacgcgccagcggtgcgtggcagtattatcgcc
aatatgctgcaggagcatgacaatccgttcacgctctatccttatgacaccaactacctc
atctacacacaaaccagcgatctgaataaagaagcgattgccagttacgactgggcggaa
aatgcgcgtaaggatgaagtaaagtttcagttgagcctggcatttccactgtggcgtggg
attttaggcccgaactcggtgttgggtgcatcttatacgcaaaaatcctggtggcaactg
tccaatagcgaagagtcttcaccgtttcgtgaaaccaactacgaaccgcaattgttcctc
ggttttgccaccgattaccgttttgcaggttggacgctgcgcgatgtggagatggggtat
aaccacgactctaacgggcgttcagacccgacctcccgcagctggaaccgcctttatact
cgcctgatggcagaaaacggtaactggctggtagaagtgaagccgtggtatgtggtgggt
aatactgacgataacccggatatcaccaaatatatgggttactaccagcttaaaatcggc
tatcacctcggtgatgcggtgctcagtgcgaaaggacagtacaactggaacaccggctac
ggcggcgcggagttaggcttaagttacccgatcaccaaacatgtgcgcctttatactcag
gtttacagcggctatggcgaatcgctcatcgactataacttcaaccagacccgtgtcggt
gtgggagttatgctaaacgatttgttttga

DBGET integrated database retrieval system