KEGG   Escherichia coli KO11FL: KO11_04240Help
Entry
KO11_04240        CDS       T02104                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ekf  Escherichia coli KO11FL
Pathway
ekf00071  Fatty acid degradation
ekf00280  Valine, leucine and isoleucine degradation
ekf00281  Geraniol degradation
ekf00310  Lysine degradation
ekf00362  Benzoate degradation
ekf00380  Tryptophan metabolism
ekf00410  beta-Alanine metabolism
ekf00640  Propanoate metabolism
ekf00650  Butanoate metabolism
ekf00903  Limonene and pinene degradation
ekf00930  Caprolactam degradation
ekf01040  Biosynthesis of unsaturated fatty acids
ekf01100  Metabolic pathways
ekf01110  Biosynthesis of secondary metabolites
ekf01120  Microbial metabolism in diverse environments
ekf01130  Biosynthesis of antibiotics
ekf01200  Carbon metabolism
ekf01212  Fatty acid metabolism
Module
ekf_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ekf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KO11_04240 (fadB)
   00650 Butanoate metabolism
    KO11_04240 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    KO11_04240 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    KO11_04240 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KO11_04240 (fadB)
   00310 Lysine degradation
    KO11_04240 (fadB)
   00380 Tryptophan metabolism
    KO11_04240 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KO11_04240 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KO11_04240 (fadB)
   00281 Geraniol degradation
    KO11_04240 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KO11_04240 (fadB)
   00930 Caprolactam degradation
    KO11_04240 (fadB)
Enzymes [BR:ekf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     KO11_04240 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KO11_04240 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     KO11_04240 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     KO11_04240 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AFH15834
Position
complement(899723..901912)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAANGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALK
IGLVDGVVKAEKLVEGAKAVLRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
GKAKKLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRP
DTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVEDLLAEVSQPKRDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPA
RPVGDLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaaaggcgacaccctgtaccttgactggctggaagatggcattgccgaactg
gtatttgatgccccaggttcagttaataaactcgacactgcgaccgtcgccagcctcggc
gaggccatcggcgtgctggaacagcaatcagatctaaaagggctgctgctgcgttcgaac
aaagcagcctttatcgtcggtgctgatatcaccgaatttttgtccctgttcctcgttcct
gaagaacagttaagtcagtggctgcactttgccaatagcgtgtttaatcgcctggaagat
ctgccggtgccgaccattgctgccgccaacggctatgcgctgggcggtggctgcgaatgc
gtgctggcgaccgattatcgtctggcgacgccggatctgcgcatcggtctgccggaaacc
aaactgggcatcatgccgggctttggcggttctgtacgtatgccacgtatgctgggcgct
gacagtgcgctggaaatcattgccgccggtaaagatgtcggcgcggatcaggcgctgaaa
atcggtctggtggatggcgtagtcaaagcagaaaaactggttgaaggcgcaaaggcggtt
ttacgccaggccattaacggcgacctcgactggaaagcaaaacgtcagccgaagctggaa
ccactaaaactgagcaagattgaagccaccatgagcttcaccatcgctaaagggatggtc
gcacaaacagcggggaaacattatccggcccccatcaccgcagtaaaaaccattgaagct
gcggcccgttttggtcgtgaagaagccttaaacctggaaaacaaaagttttgtcccgctg
gcgcataccaacgaagcccgcgcactggtcggcattttccttaacgatcaatatgtaaaa
ggcaaagcgaagaaactcaccaaagacgttgaaaccccgaaacaggccgcggtgctgggt
gcaggcattatgggcggcggcatcgcttaccagtctgcgtggaaaggcgtgccggttgtc
atgaaagatatcaacgacaagtcgttaaccctcggcatgaccgaagccgcgaaactgctg
aacaagcagcttgagcgcggcaagatcgatggtctgaaactggctggcgtgatctccaca
atccacccaacgctcgactacgccgggtttgaccgcgtggatgttgtggtagaagcggtt
gtcgaaaacccgaaagtgaaaaaagccgtactggcagaaaccgaacaaaaagtacgcccg
gataccgtgctggcgtctaacacttcaaccattcctatcagcgaactggccaacgcgctg
gaacgcccggaaaacttctgcggaatgcacttttttaacccggtacaccggatgccgttg
gtagaaattattcgcggcgagaaaagctccgacgaaaccatcgcgaaagttgtcgcctgg
gcgagcaagatgggcaagacgccgattgtggttaacgactgccccggcttctttgttaac
cgcgtgctgttcccgtatttcgccggtttcagccagctgctgcgcgacggcgcggatttc
cgcaagatcgacaaagtgatggaaaaacagtttggctggcctatgggtccggcatatctg
ctggatgtcgtgggcattgataccgcgcatcacgctcaggctgtcatggcagcaggcttc
ccgcagcggatgcagaaagattaccgcgatgccatcgacgcgctgtttgatgccaaccgc
tttggtcagaagaacggcctcggtttctggcgttataaagaagacagcaaaggtaagccg
aagaaagaagaagacgccgccgttgaagacctgctggcagaagtgagccagccgaagcgc
gatttcagcgaagaagagattatcgcccgcatgatgatcccgatggtcaacgaagtggtg
cgctgtctggaggaaggcattatcgccactccggcggaagcggatatggcgctggtctac
ggcctgggcttccctccgttccacggcggcgcgttccgctggctggacaccctcggtagc
gcaaaatacctcgatatggcacagcaatatcagcacctcggcccgctgtatgaagtgccg
gaaggtctgcgtaataaagcgcgtcataacgaaccgtactatcctccggttgagccagcc
cgtccggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system