KEGG   Escherichia coli KO11FL: KO11_08065Help
Entry
KO11_08065        CDS       T02104                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ekf  Escherichia coli KO11FL
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ekf00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1707942..1708862
Genome map
AA seq 306 aa AA seqDB search
MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIR
QVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRML
SFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNH
SVQIGIRTEFDIDNGFTVLDACQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAP
GTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQ
AAKKGE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccttaggtcatcaatacgataactcactggtttccaacgcctttggtttttta
cgcctgccgatgaacttccagccgtatgacagcgatgctgactgggtgattactggtgtg
ccgttcgacatggccacctctggccgtgccggtggtcgccacggtccggcagcgatccgt
caggtttcgacgaatctggcctgggaacacaatcgcttcccgtggaatttcgacatgcgt
gagcgtctgaacgtcgtggactgcggtgatctggtatatgctttcggcgatgcccgtgag
atgagcgagaagctgcaggcgcacgccgagaagctgctggctgccggtaagcgtatgctc
tccttcggtggtgaccactttgttacgctgccgctgctgcgtgctcatgcgaagcatttc
ggtaaaatggcgctggtacactttgacgcccacaccgatacctatgcgaacggttgtgaa
tttgaccacggcaccatgttctataccgcgccgaaagaaggtctgatcgacccgaatcat
tccgtgcagattggtattcgtaccgagtttgatatagacaacggctttaccgtgctggac
gcctgccaggtgaacgatcgcagcgtggatgacgttatcgcccaggtgaaacagattgtg
ggtgatatgccggtttacctgacctttgatatcgactgcctggatcctgcttttgcacca
ggcaccggtacgccagtgattggcggcctgacctccgatcgcgctattaaactggtacgc
ggcctgaaagatctcaacatcgttgggatggacgtagtggaagtggctccggcatatgat
cagtcggaaatcaccgctctggctgcggcgacgctggcgctggagatgctgtatattcag
gcggcgaaaaagggcgagtaa

DBGET integrated database retrieval system