KEGG   Escherichia coli KO11FL: KO11_08260Help
Entry
KO11_08260        CDS       T02104                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ekf  Escherichia coli KO11FL
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ekf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KO11_08260 (bglA)
Enzymes [BR:ekf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     KO11_08260 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1750162..1751595)
Genome map
AA seq 477 aa AA seqDB search
MKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVLPGKYYP
NHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMFDELL
KYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEIN
NQRNWRAPLFGYCCSGVVYTEHDNPEETMYQVLHHQFVASALAVKAARRINPEMKVGCML
AMVPLYPYCCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGDLD
VLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRYAL
CELYERYQRPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLMGY
TPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGAGDMSRSRKKSFNWYQEVIASNGEKL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaactcaccttaccgaaagatttcttatggggcggcgcagttgccgctcatcag
gtcgaaggcggctggaacaaaggcggcaaagggccgagcatttgtgacgttctgaccggt
ggcgcacacggcgtgccgcgcgaaatcaccaaagaagtcttgccaggcaaatactatcca
aaccatgaagccgttgatttttatggtcactacaaggaagacatcaagctatttgccgaa
atgggcttcaaatgttttcggacttccatcgcctggacgcgtatttttccaaaaggtgat
gaagctcagccaaacgaagaagggctgaagttctacgatgatatgttcgatgaactgctg
aaatacaacatcgaaccggtgatcaccctctcccactttgaaatgccgctgcatctggtg
cagcaatacggtagctggaccaaccgtaaagtggttgatttctttgtccgtttcgcggaa
gtggtgtttgaacgctataagcataaagtcaaatactggatgaccttcaacgaaattaac
aaccagcgtaactggcgtgcaccgctgttcggttactgctgctccggcgtggtttatacc
gagcatgacaacccggaagagacgatgtaccaggtgctgcatcaccagtttgtcgccagc
gccctggcggtgaaagctgcgcgtcgcattaacccggagatgaaagtcggctgtatgctg
gcgatggtgccgctctatccctactgctgtaacccggacgatgtgatgttcgctcaggag
tcgatgcgcgaacgctacgtctttaccgatgtgcagctacgcggctattacccgtcctat
gtgttgaacgagtgggagcgtcgcggatttaacatcaaaatggaagacggcgatctcgat
gtactgcgtgaaggcacctgcgattatcttggtttcagctattacatgaccaacgcagtg
aaggccgaaggcggcaccggcgatgcgatctctggtttcgaaggcagcgtaccgaacccg
tatgttaaagcgtctgactggggctggcagattgatccagtaggtctgcgctatgccctt
tgcgaactgtatgagcgttatcagaggccgctgtttattgtcgaaaacggttttggcgct
tacgacaaagtggaagaagatggcagcatcaacgacgactaccgcattgactacctgcgc
gcccatatcgaagagatgaaaaaagcggtgacttacgatggcgtggatctgatgggctac
acaccgtggggctgcatcgactgcgtatcgttcaccaccgggcagtacagcaaacgctac
ggctttatctatgtgaataaacatgacgacggtgctggcgatatgtcgcgttcacgtaag
aagagctttaactggtaccaagaggtgattgccagcaacggcgagaagctttaa

DBGET integrated database retrieval system