KEGG   Escherichia coli KO11FL: KO11_08590Help
Entry
KO11_08590        CDS       T02104                                 

Gene name
kduI
Definition
5-keto-4-deoxyuronate isomerase (EC:5.3.1.17)
Orthology
K01815  
4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase [EC:5.3.1.17]
Organism
ekf  Escherichia coli KO11FL
Pathway
Pentose and glucuronate interconversions
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ekf00040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1819126..1819962
Genome map
AA seq 278 aa AA seqDB search
MDVRQSIHSAHAKTLDTQGLRNEFLVEEVFVADEYTMVYSHIDRIIVGGIMPITKTVSVG
GEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDALYVGKGAKEVVFASIDT
ATPAKFYYNCAPAHTTYPTKKVTPDEVAPVTLGDNLTSNRRTINKYFVPDVLETCQLSMG
LTELAPGNLWNTMPCHTHERRMEVYFYFNMDDDACVFHMMGQPQETRHIVMHNEQAVISP
SWSIHSGVGTKAYTFIWGMVGENQVFDDMDHVAVKDLR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtggacgtaagacagagcatccacagtgcgcacgcaaaaacgctggatacccaagggctg
cgcaatgaatttttggttgaagaggtatttgtcgccgatgagtacaccatggtttacagc
cacattgaccgaattattgttggcggcattatgccgataactaaaacggtttccgttggc
ggggaagttggtaaacaactcggcgtaagctatttccttgaacgtcgcgagttaggtgtt
atcaatattggcggtgccggtacgattactgtcgatggccaatgctatgaaatcggtcac
cgcgacgccctgtatgtgggtaaaggtgcaaaagaagttgtctttgccagtattgatacc
gccactccggcaaagttttattacaattgcgcacccgcgcatacgacgtatcccaccaaa
aaagtcaccccggacgaagtagctccagtcacgttaggcgataacctcaccagtaaccgt
cgcactattaacaaatattttgtcccggatgtgctggaaacctgccaattgagtatgggg
ctgacggagctggctccgggtaacttgtggaacaccatgccgtgtcacacccacgagcgc
cggatggaagtttatttctatttcaatatggatgatgacgcctgcgttttccacatgatg
gggcagccgcaagaaacgcgtcacattgtgatgcataacgagcaggcggtgatctccccg
agctggtcgattcattccggcgtcggaaccaaagcttatacctttatctggggcatggtc
ggtgaaaaccaggtctttgatgatatggaccatgtggccgttaaagatttgcgctag

DBGET integrated database retrieval system