KEGG   Escherichia coli KO11FL: KO11_12600Help
Entry
KO11_12600        CDS       T02104                                 

Gene name
galF
Definition
GalU regulator GalF (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ekf  Escherichia coli KO11FL
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ekf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KO11_12600 (galF)
   00052 Galactose metabolism
    KO11_12600 (galF)
   00500 Starch and sucrose metabolism
    KO11_12600 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    KO11_12600 (galF)
Enzymes [BR:ekf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KO11_12600 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2704140..2705033
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLELRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttattcctgtagcgggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcatgcgtccaag
aacgcggtcgaaaaccacttcgacacctcttatgaattagaatctcttcttgaactgcgc
gtgaagcgtcaactactggcggaagttcagtccatctgcccgccgggcgtgaccattatg
aacgtacgtcagggcgaacctttaggtttaggtcactccattttgtgtgcacgacccgcc
attggtgacaacccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagtgcc
gacccgctgcgctacaaccttgcagccatgattgcgcgcttcaacgaaacgggccgcagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactccgtcattcagaccaaa
gaaccactggatcgtgaaggtaaagtcagccgcattgttgaatttatcgaaaaaccggat
cagccgcagacgctggattcagacatcatggccgttggtcgctatgtgctttctgcagat
atttggccggaacttgaacgcactcagcctggtgcatgggggcgtattcagctgactgat
gccatcgctgaactggcgaaaaaacagtctgttgatgccatgctgatgacaggtgacagc
tacgactgcggtaaaaaaatgggttatatgcaggcatttgtgaagtatggactacgcaac
ctgaaagaaggggcgaagttccgtaaaggtattgagaagctgttaagcgaataa

DBGET integrated database retrieval system