KEGG   Escherichia coli KO11FL: KO11_14125Help
Entry
KO11_14125        CDS       T02104                                 

Gene name
pfkB
Definition
(GenBank) 6-phosphofructokinase 2
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
ekf  Escherichia coli KO11FL
Pathway
ekf00010  Glycolysis / Gluconeogenesis
ekf00030  Pentose phosphate pathway
ekf00051  Fructose and mannose metabolism
ekf00052  Galactose metabolism
ekf00680  Methane metabolism
ekf01100  Metabolic pathways
ekf01110  Biosynthesis of secondary metabolites
ekf01120  Microbial metabolism in diverse environments
ekf01130  Biosynthesis of antibiotics
ekf01200  Carbon metabolism
ekf01230  Biosynthesis of amino acids
Module
ekf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ekf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KO11_14125 (pfkB)
   00030 Pentose phosphate pathway
    KO11_14125 (pfkB)
   00051 Fructose and mannose metabolism
    KO11_14125 (pfkB)
   00052 Galactose metabolism
    KO11_14125 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    KO11_14125 (pfkB)
Enzymes [BR:ekf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KO11_14125 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617
Motif
Other DBs
NCBI-ProteinID: AFH17797
Structure
PDB: 

Jmol
Position
complement(3003856..3004785)
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFP
AGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQ
LEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQNQGIRCIIDSSGEALSAALAIGN
IELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDT
QKIYAYLSR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacacttgcgccctctctcgatagcgcaacaattaccccg
caaatttatcccgaaggaaaactgcgctgtaccgcaccggtgttcgaacccgggggcggc
ggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttcccg
gcgggtggcgcgaccggcgaacacctggtttctctgttggcggatgaaaatgtccccgtc
gctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagcaagc
ggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgccag
cttgaagagcaagttctggaaattgaatccggggccatcctggtcataagcggaagcctg
ccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaccaaggg
atccgctgcatcatcgacagttctggcgaagcgttaagtgcagcactggcgattggtaac
atcgagttggttaagcctaaccaaaaagaactcagtgcgctggtgaatcgcgaactcacc
cagccagacgatgtccgcaaagccgcgcaggaaatcgttaatagcggcaaggccaaacgg
gttgtcgtttcccttggtccacaaggagcgctgggtgttgatagtgaaaactgcattcag
gtggtgccaccaccggtgaaaagccagagtaccgttggcgctggtgacagcatggtcggc
gcgatgacactgaaactggcagaaaatgcctctcttgaagagatggtccgttttggcgta
gctgcggggagtgcagccacactcaatcagggaacacgtctgtgctcccatgacgatacg
caaaaaatttacgcttacctttcccgctaa

DBGET integrated database retrieval system