KEGG   Escherichia coli KO11FL: KO11_15015Help
Entry
KO11_15015        CDS       T02104                                 

Gene name
arrQ
Definition
putative endolysin
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ekf  Escherichia coli KO11FL
Brite
Enzymes [BR:ekf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     KO11_15015 (arrQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3182759..3183292
Genome map
AA seq 177 aa AA seqDB search
MNTKIRYGLSAAVLALIGAGASAPQILDQFLDEKEGNHTMAYRDGSGIWTICRGATVVDG
KTVFPNMKLSKEKCDQVNAIERDKALAWVERNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYKRLNAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVIRRDQESALTCWGIEQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaaaaatcagatacggcctgtcggctgccgttctggcgctgattggtgctggc
gcatctgctcctcagatacttgaccagtttctggacgaaaaagaaggtaaccacacaatg
gcataccgcgatggttctggcatatggaccatctgtcggggtgccacagtggtggatgga
aaaaccgtttttcccaatatgaaactgtcgaaggaaaaatgcgaccaggtcaacgccatt
gagcgtgataaggcgctggcatgggtggagcgcaatattaaagtaccactgaccgaacca
caaaaagcgggtatcgcgtcattttgtccctataacattggccccggtaagtgtttcccg
tcgacgttttataagcggctgaatgctggtgatcgtaaaggtgcatgcgaagcgattcgc
tggtggattaaggatggcggacgcgattgccgcattcgttcaaataactgttacggtcag
gttattcgtcgtgaccaggagagcgcattaacctgctgggggatagaacagtga

DBGET integrated database retrieval system