KEGG   Escherichia coli KO11FL: KO11_15500Help
Entry
KO11_15500        CDS       T02104                                 

Gene name
bcgA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ekf  Escherichia coli KO11FL
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ekf00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3277768..3279183
Genome map
AA seq 471 aa AA seqDB search
MRGSLRAAHQLEGGWNEGGKGISIADVMTAGAHGVPREVTEGVIDGLNYPNHEAIDFYHR
YKTDIQLFAEMGFKCFRTSIAWTRIFPQGDEQEPNEEGLQFYDDLFDECLKQGMEPVVTL
SHFEMPYHLVTKYGGWRNRKLIDFFIRFASTVFTRYKEKVKYWMTFNEINNQVNFSESLC
PFTNSGILYSPEEDINEREQIMYQAVHYELVASALAVQTGKSINPEFNIGCMIAMCPIYP
LTCAPNDMMMATKAMHRRYWFTDVHARGYYPQHMLNYFARKGFNLDITPEDNAILASGCV
DFIGFSYYMSFTTQFSPDNPQLDYVEPRDLVSNPYIDTSEWGWQIDPAGLRYSLNWFWDH
FQLPLFIVENGFGAVDQRQADGTVNDHYRIDYFASHIREMKKAVVEDGVDLIGYTPWGCI
DLVSAGTGEMKKRYGMIYVDKDNEGKGTLERIRKASFYWYRDLIANNGENI
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaggggatctctcagagccgcgcatcagttggaaggtggctggaatgaaggaggaaaa
ggcatcagcatcgctgatgtgatgactgctggcgctcacggggtgccgcgtgaagtgaca
gaaggcgttatcgacgggcttaattatcccaatcatgaagcaattgatttttatcatcgc
tataaaacagatattcagttatttgccgagatgggattcaaatgctttcgaacttccatt
gcctggacacgaatctttccgcaaggtgacgaacaggagccgaatgaagagggtttacaa
ttttatgatgatctgttcgatgaatgccttaagcagggaatggaacctgtggtgacgctt
tcacattttgagatgccttatcatctggtgacaaaatatggtggctggcgaaaccgtaaa
ctgatcgacttttttatccgcttcgcatcaacggtcttcacgcgctataaagaaaaagta
aagtactggatgacgtttaacgaaatcaataatcaggtgaatttcagcgaaagcctgtgt
ccatttactaattccggtatcttgtattcgccagaggaagatatcaatgagcgcgaacaa
ataatgtaccaggcggtacattacgagttagttgccagtgccctggcggtacagactgga
aaatcgatcaatcctgaatttaacattggctgtatgatcgccatgtgtcccatctatcct
ctgacgtgtgcacccaacgatatgatgatggccacgaaagcaatgcatcgtcgttactgg
tttactgatgttcatgctcgtggatattatccgcaacatatgctgaattactttgccagg
aaaggattcaacctcgatatcacaccagaagataacgcgattcttgccagtggttgtgtc
gactttatcggctttagctactacatgtcttttacgacacaattttcgcccgataacccg
caactggattatgttgaaccacgagatttggtcagcaacccttatatcgatacatccgaa
tggggatggcaaattgatccggcagggctacgttattcactcaactggttctgggatcat
ttccagttgccgctgtttattgtcgaaaatggatttggtgcggttgaccagagacaagct
gacggcacggtgaacgatcactatcgcattgattactttgcttcccatattcgggaaatg
aaaaaagccgtagttgaagatggtgttgacttaattggctacaccccgtggggctgcatt
gacctggtttctgccggaacaggggaaatgaaaaagcgctacggaatgatttatgtcgat
aaagacaacgaagggaagggaacgctggaacggatacgtaaagcgtcgttttactggtat
cgggatctcatcgccaacaatggcgaaaatatttga

DBGET integrated database retrieval system