KEGG   Escherichia coli KO11FL: KO11_15560Help
Entry
KO11_15560        CDS       T02104                                 

Gene name
uxaB
Definition
altronate oxidoreductase (EC:1.1.1.58)
Orthology
K00041  
tagaturonate reductase [EC:1.1.1.58]
Organism
ekf  Escherichia coli KO11FL
Pathway
Pentose and glucuronate interconversions
Metabolic pathways
Module
D-Galacturonate degradation (bacteria), D-galacturonate => pyruvate + D-glyceraldehyde 3P
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ekf00040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3289264..3290715
Genome map
AA seq 483 aa AA seqDB search
MKTLNRRDFPGAQYPERIIQFGEGNFLRAFVDWQIDLLNEHTDLNSGVVVVRPIETSFPP
SLSTQDGLYTTIIRGLNEKGEAVSDARLIRSVNREISVYSEYDEFLKLAHNPEMRFVFSN
TTEAGISYHAGDKFDDAPAVSYPAKLTRLLFERFSHFNGALDKGWIIIPCELIDYNGDAL
RELVLRYAQEWALPEAFIQWLDQANSFCSTLVDRIVTGYPRDEVAKLEEELGYHDGFLDT
AEHFYLFVIQGPKSLATELRLDKYPLNVLIVDDIKPYKERKVAILNGAHTALVPVAFQAG
LDTVGEAMNDAEICAFVEKAIYEEIIPVLDLPRDELESFASAVTGRFRNPYIKHQLLSIA
LNGMTKFRTRILPQLLAGQKAKGTLPARLTFALAALIAFYRGERNGETYPVQDDAHWLER
YQQLWSQHRDRVIGTQELVAIVLAEKDHWEQDLTQVPGLVEQVANDLDAILEKGMREAVR
PLC
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacactaaatcgtcgcgattttcccggtgcacagtatccagaacgtatcattcag
tttggtgaaggtaacttcctgcgcgcctttgttgactggcaaatcgatctcctgaatgag
cacaccgatctgaattctggcgtggtcgttgttcgtccgattgaaacttcattcccgccg
tcactgagcacgcaggatggtctgtacaccaccattatccgtggcctgaatgagaagggg
gaagcggtcagcgacgcgcgtctgattcgctcggttaatcgtgaaatcagcgtctacagt
gaatacgatgaattcctgaaactggcgcacaacccggaaatgcgctttgttttctctaac
accaccgaagcggggatcagctaccatgcgggcgataaattcgatgacgcaccagcggta
agctatccggcaaaactgacccgtctgctgttcgaacgctttagccatttcaacggtgcg
ctggataaaggttggatcatcattccgtgtgagttgattgactacaatggcgacgcgttg
cgtgaactggtgctgcgctatgcgcaagagtgggcactgccagaagcatttattcaatgg
ctggatcaggctaacagcttctgttctacgctggtggaccgtatcgttaccggttatccg
cgcgatgaagtggctaaactggaagaagaactgggttatcacgatggtttcctcgacacc
gctgaacacttttacctgtttgtgattcaggggccgaaatccttagcgactgagctgcgc
ctggacaaatatccgctcaacgtgctgattgttgacgatattaaaccgtataaagaacgc
aaagtggcaatcctcaacggtgcgcacaccgcgctggtgccggtggcgttccaggcaggg
ctggataccgtaggtgaagcgatgaacgatgctgaaatttgcgcattcgttgaaaaagcc
atctacgaagaaattattccggtactggatttgcctcgtgatgaactggaatctttcgcc
agtgcagtcaccgggcgtttccgtaacccgtacattaagcatcagctgctgtctatcgcg
ctcaacggtatgaccaagttccgcacccgcatcctgccgcagctgctggcagggcagaag
gcaaaaggcacacttccggcgcgccttactttcgcattagcggcattgattgccttctat
cgcggtgagcgtaacggagaaacatatccggtacaggacgatgcacactggctggaacgt
tatcagcaactctggagccagcatcgtgaccgtgttatcggcacccaggaactggtagcg
attgttttggcagaaaaagaccactgggagcaggacctgacgcaagtgcctggtctggtc
gagcaggttgctaatgacctggatgcgattcttgaaaaagggatgcgcgaagctgtacgt
ccgttgtgctaa

DBGET integrated database retrieval system