KEGG   Escherichia coli KO11FL: KO11_17300Help
Entry
KO11_17300        CDS       T02104                                 

Gene name
rne
Definition
ribonuclease E
Orthology
K08300  
ribonuclease E [EC:3.1.26.12]
Organism
ekf  Escherichia coli KO11FL
Pathway
RNA degradation
Module
RNA degradosome
Brite
KEGG Orthology (KO) [BR:ekf00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    KO11_17300 (rne)
Enzymes [BR:ekf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.12  ribonuclease E
     KO11_17300 (rne)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3636347..3639532
Genome map
AA seq 1061 aa AA seqDB search
MKRMLINATQQEELRVALVDGQRLYDLDIESPGHEQKKANIYKGKITRIEPSLEAAFVDY
GAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEVIVQIDKEERGNKGAALTTFI
SLAGSYLVLMPNNPRAGGISRRIEGDDRTELKEALASLELPEGMGLIVRTAGVGKSAEAL
QWDLSFRLKHWEAIKKAAESRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELA
RQHIAALGRPDFSSKIKLYTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALT
AIDINSARATRGGDIEETAFNTNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQRAVE
NRLREAVRQDRARIQISHISRFGLLEMSRQRLSPSLGESSHHVCPRCSGTGTVRDNESLS
LSILRLIEEEALKENTQEVHAIVPVPIASYLLNEKRSAVNAIETRQDGVRCVIVPNDQME
TPHYHVLRVRKGEETPTLSYMLPKLHEEAMALPSEEEFAERKRPEQPALATFAMPDVPPA
PTPAEPAAPVVAPSPKAAPATPAAPAQPGLLSRFFGALKALFSGGEETKPTEQPAPKAEA
KPERQQDRRKPRQNSRRDRNERRDTRSERTEGSDNREENRRNRRQAQQQTAETRESRQQT
EVTEKARTTDEQQAPRRERSRRRNDDKRQAQQEAKALNVEEQSVQETEQEERVRPVQPRR
KQRQLNQKVRYEQSVAEEAVVAPVVEETVAAEPIVQEAPAPRTELVKVPLPVVAQTAPEQ
QEENNADNRDNGGMPRRSRRSPRHLRVSGQRRRRYRDERYPTQSPMPLTVACASPELASG
KVWIRYPIVRPQDVQVEEQREQEEVQVQPMVTEVPVAAAIEPVVSAPVIEEVAEVVEAPV
QVAEPQPEVVETTHPEVIAAAVTEQPQVITESDVAVAQEVAEHAEPVVEPQEETADIEEV
AETAEVVVAEPEVVTQPAAPVVAEVAAEVETVAAVEPEITVEHNHATAPMTRAPAPEYVP
EAPRHSDWQRPTFAFEGKGAAGGHTATHHASAAPARPQPVE
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatgttaatcaacgcaactcagcaggaagagttgcgcgttgcccttgtagat
gggcagcgtctgtatgacctggatatcgaaagtccagggcacgagcagaaaaaggcaaac
atctacaaaggtaaaatcacccgcattgaaccgagtctggaagctgcttttgttgattac
ggcgctgaacgtcacggtttcctcccactaaaagaaattgcccgcgaatatttccctgct
aactacagtgctcatggtcgtcccaacattaaagatgtgttgcgtgaaggtcaggaagtc
attgttcagatcgataaagaagagcgcggaaacaaaggcgcggcattaaccacctttatc
agtctggcgggtagctatctggttctgatgccgaacaacccgcgcgcgggtggcatttct
cgccgtatcgaaggcgacgaccgtaccgaattaaaagaagcactggcaagccttgaactg
ccggaaggcatggggcttatcgtgcgcaccgctggcgtcggcaaatctgctgaggcgctg
caatgggatttaagcttccgtctgaaacactgggaagccatcaaaaaagccgctgaaagc
cgcccggctccgttcctgattcatcaggagagcaacgtaatcgttcgcgcattccgcgat
tacttacgtcaggacatcggcgaaatccttatcgataacccgaaagtgctcgaactggca
cgtcagcatatcgctgcattaggtcgcccggatttcagcagcaaaatcaaactgtacacc
ggcgagatcccgctgttcagccactaccagatcgagtcgcagatcgaatccgccttccag
cgtgaagtccgtctgccatccggtggttccattgttatcgacagcaccgaagcgttaact
gccatcgacatcaactccgcacgcgcgacccgcggcggcgatatcgaagaaaccgcgttt
aacaccaacctcgaagctgccgatgagattgctcgtcagctgcgcctgcgtgacctcggc
ggcctgattgttatcgacttcatcgacatgacgccagtacgccaccagcgtgcggtagaa
aaccgtctgcgtgaagcggtgcgtcaggaccgtgcgcgtattcaaatcagccatatttct
cgctttggcctgctggaaatgtcccgtcagcgcctgagcccatcactgggtgaatccagt
catcacgtttgtccgcgttgttctggtactggcaccgtgcgtgacaacgaatcgctgtcg
ctctctattctgcgtctgatcgaagaagaagcgctgaaagagaacacccaggaagttcac
gccattgttcctgtgccaatcgcttcttacctgctgaatgaaaaacgttctgcggtgaat
gccattgaaacgcgtcaggacggtgttcgctgcgtgattgtgccaaacgatcagatggaa
accccgcactaccacgtgctgcgcgtgcgtaaaggggaagaaaccccaaccttaagctac
atgctgccgaagctgcatgaagaagcgatggcgctgccgtctgaagaagagttcgctgaa
cgtaagcgtccggaacaacctgcgctggcaacctttgccatgccggatgtgccgccagcg
ccaacgccagctgaacctgccgcgcctgtcgtagctccatcaccgaaagctgcaccggca
acaccagcagctcctgcacaacctgggctgttgagccgcttcttcggcgcactgaaagcg
ctgttcagcggtggtgaagaaaccaaaccgaccgagcaaccagcaccgaaagcagaagcg
aaaccggaacgtcaacaggatcgtcgcaagcctcgtcagaacagccgccgtgaccgtaat
gagcgccgcgacacccgtagcgaacgtactgaaggcagcgataatcgcgaagaaaaccgt
cgtaatcgtcgccaggcacagcagcagactgccgagacgcgtgagagccgtcagcagact
gaggtaacggaaaaagcgcgtaccaccgacgagcagcaagcgccgcgtcgtgaacgtagc
cgccgccgtaacgatgataaacgtcaggcgcaacaagaagcgaaggcgctgaatgttgaa
gagcaatctgttcaggaaaccgaacaggaagaacgtgtacgtccggttcagccgcgtcgt
aaacagcgtcagctcaatcagaaagtgcgttacgagcaaagcgtagccgaagaagcggta
gtcgcaccggtggttgaagaaactgtcgctgccgaaccaattgttcaggaagcgccagct
ccacgcacagaactggtgaaagtcccgctgccagtcgtagcgcaaactgcaccagaacag
caagaagagaacaatgccgataaccgtgacaacggtggtatgccgcgtcgttctcgccgc
tcgcctcgtcacctgcgcgtgagtggtcagcgtcgtcgtcgctatcgtgacgagcgttat
ccaacccagtcgccaatgccgttgaccgtagcgtgcgcgtctccggaactggcctctggc
aaagtctggatccgctatccaattgtacgtccgcaagatgtacaggttgaagagcagcgc
gaacaggaagaagtacaagtgcagccgatggtgactgaggtccctgtcgccgccgctatc
gaaccggttgttagcgcgccagttattgaagaagtggctgaagtcgtagaagcccccgtt
caggttgccgaaccgcaaccggaagtggttgaaacgacgcatcctgaagtaattgccgcc
gcggtaactgaacagccgcaggtgattaccgagtctgatgttgccgtagcccaggaagtt
gcagaacacgcagaaccggtggttgaaccgcaggaagagacggcagatattgaagaagtt
gccgaaactgctgaggttgtggttgctgaacctgaagttgttactcaacctgccgcgcca
gtcgtcgctgaagtcgcagcagaagttgaaacggtagccgcggttgaacctgagatcacc
gttgagcataaccacgctaccgcgccaatgacacgcgctccggcaccggaatatgttccg
gaggcaccacgtcacagtgactggcagcgccctacttttgccttcgaaggtaaaggtgcc
gcaggtggtcatacggcaacgcatcatgcctctgccgctcctgcgcgtccgcaacctgtt
gagtaa

DBGET integrated database retrieval system