KEGG   Escherichia coli KO11FL: KO11_17300Help
Entry
KO11_17300        CDS       T02104                                 

Gene name
rne
Definition
ribonuclease E
Orthology
K08300  
ribonuclease E [EC:3.1.26.12]
Organism
ekf  Escherichia coli KO11FL
Pathway
RNA degradation
Module
RNA degradosome
Class
Genetic Information Processing; Folding, sorting and degradation; RNA degradation [PATH:ekf03018]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3636347..3639532
Genome map
AA seq 1061 aa AA seqDB search
MKRMLINATQQEELRVALVDGQRLYDLDIESPGHEQKKANIYKGKITRIEPSLEAAFVDY
GAERHGFLPLKEIAREYFPANYSAHGRPNIKDVLREGQEVIVQIDKEERGNKGAALTTFI
SLAGSYLVLMPNNPRAGGISRRIEGDDRTELKEALASLELPEGMGLIVRTAGVGKSAEAL
QWDLSFRLKHWEAIKKAAESRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELA
RQHIAALGRPDFSSKIKLYTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALT
AIDINSARATRGGDIEETAFNTNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQRAVE
NRLREAVRQDRARIQISHISRFGLLEMSRQRLSPSLGESSHHVCPRCSGTGTVRDNESLS
LSILRLIEEEALKENTQEVHAIVPVPIASYLLNEKRSAVNAIETRQDGVRCVIVPNDQME
TPHYHVLRVRKGEETPTLSYMLPKLHEEAMALPSEEEFAERKRPEQPALATFAMPDVPPA
PTPAEPAAPVVAPSPKAAPATPAAPAQPGLLSRFFGALKALFSGGEETKPTEQPAPKAEA
KPERQQDRRKPRQNSRRDRNERRDTRSERTEGSDNREENRRNRRQAQQQTAETRESRQQT
EVTEKARTTDEQQAPRRERSRRRNDDKRQAQQEAKALNVEEQSVQETEQEERVRPVQPRR
KQRQLNQKVRYEQSVAEEAVVAPVVEETVAAEPIVQEAPAPRTELVKVPLPVVAQTAPEQ
QEENNADNRDNGGMPRRSRRSPRHLRVSGQRRRRYRDERYPTQSPMPLTVACASPELASG
KVWIRYPIVRPQDVQVEEQREQEEVQVQPMVTEVPVAAAIEPVVSAPVIEEVAEVVEAPV
QVAEPQPEVVETTHPEVIAAAVTEQPQVITESDVAVAQEVAEHAEPVVEPQEETADIEEV
AETAEVVVAEPEVVTQPAAPVVAEVAAEVETVAAVEPEITVEHNHATAPMTRAPAPEYVP
EAPRHSDWQRPTFAFEGKGAAGGHTATHHASAAPARPQPVE
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatgttaatcaacgcaactcagcaggaagagttgcgcgttgcccttgtagat
gggcagcgtctgtatgacctggatatcgaaagtccagggcacgagcagaaaaaggcaaac
atctacaaaggtaaaatcacccgcattgaaccgagtctggaagctgcttttgttgattac
ggcgctgaacgtcacggtttcctcccactaaaagaaattgcccgcgaatatttccctgct
aactacagtgctcatggtcgtcccaacattaaagatgtgttgcgtgaaggtcaggaagtc
attgttcagatcgataaagaagagcgcggaaacaaaggcgcggcattaaccacctttatc
agtctggcgggtagctatctggttctgatgccgaacaacccgcgcgcgggtggcatttct
cgccgtatcgaaggcgacgaccgtaccgaattaaaagaagcactggcaagccttgaactg
ccggaaggcatggggcttatcgtgcgcaccgctggcgtcggcaaatctgctgaggcgctg
caatgggatttaagcttccgtctgaaacactgggaagccatcaaaaaagccgctgaaagc
cgcccggctccgttcctgattcatcaggagagcaacgtaatcgttcgcgcattccgcgat
tacttacgtcaggacatcggcgaaatccttatcgataacccgaaagtgctcgaactggca
cgtcagcatatcgctgcattaggtcgcccggatttcagcagcaaaatcaaactgtacacc
ggcgagatcccgctgttcagccactaccagatcgagtcgcagatcgaatccgccttccag
cgtgaagtccgtctgccatccggtggttccattgttatcgacagcaccgaagcgttaact
gccatcgacatcaactccgcacgcgcgacccgcggcggcgatatcgaagaaaccgcgttt
aacaccaacctcgaagctgccgatgagattgctcgtcagctgcgcctgcgtgacctcggc
ggcctgattgttatcgacttcatcgacatgacgccagtacgccaccagcgtgcggtagaa
aaccgtctgcgtgaagcggtgcgtcaggaccgtgcgcgtattcaaatcagccatatttct
cgctttggcctgctggaaatgtcccgtcagcgcctgagcccatcactgggtgaatccagt
catcacgtttgtccgcgttgttctggtactggcaccgtgcgtgacaacgaatcgctgtcg
ctctctattctgcgtctgatcgaagaagaagcgctgaaagagaacacccaggaagttcac
gccattgttcctgtgccaatcgcttcttacctgctgaatgaaaaacgttctgcggtgaat
gccattgaaacgcgtcaggacggtgttcgctgcgtgattgtgccaaacgatcagatggaa
accccgcactaccacgtgctgcgcgtgcgtaaaggggaagaaaccccaaccttaagctac
atgctgccgaagctgcatgaagaagcgatggcgctgccgtctgaagaagagttcgctgaa
cgtaagcgtccggaacaacctgcgctggcaacctttgccatgccggatgtgccgccagcg
ccaacgccagctgaacctgccgcgcctgtcgtagctccatcaccgaaagctgcaccggca
acaccagcagctcctgcacaacctgggctgttgagccgcttcttcggcgcactgaaagcg
ctgttcagcggtggtgaagaaaccaaaccgaccgagcaaccagcaccgaaagcagaagcg
aaaccggaacgtcaacaggatcgtcgcaagcctcgtcagaacagccgccgtgaccgtaat
gagcgccgcgacacccgtagcgaacgtactgaaggcagcgataatcgcgaagaaaaccgt
cgtaatcgtcgccaggcacagcagcagactgccgagacgcgtgagagccgtcagcagact
gaggtaacggaaaaagcgcgtaccaccgacgagcagcaagcgccgcgtcgtgaacgtagc
cgccgccgtaacgatgataaacgtcaggcgcaacaagaagcgaaggcgctgaatgttgaa
gagcaatctgttcaggaaaccgaacaggaagaacgtgtacgtccggttcagccgcgtcgt
aaacagcgtcagctcaatcagaaagtgcgttacgagcaaagcgtagccgaagaagcggta
gtcgcaccggtggttgaagaaactgtcgctgccgaaccaattgttcaggaagcgccagct
ccacgcacagaactggtgaaagtcccgctgccagtcgtagcgcaaactgcaccagaacag
caagaagagaacaatgccgataaccgtgacaacggtggtatgccgcgtcgttctcgccgc
tcgcctcgtcacctgcgcgtgagtggtcagcgtcgtcgtcgctatcgtgacgagcgttat
ccaacccagtcgccaatgccgttgaccgtagcgtgcgcgtctccggaactggcctctggc
aaagtctggatccgctatccaattgtacgtccgcaagatgtacaggttgaagagcagcgc
gaacaggaagaagtacaagtgcagccgatggtgactgaggtccctgtcgccgccgctatc
gaaccggttgttagcgcgccagttattgaagaagtggctgaagtcgtagaagcccccgtt
caggttgccgaaccgcaaccggaagtggttgaaacgacgcatcctgaagtaattgccgcc
gcggtaactgaacagccgcaggtgattaccgagtctgatgttgccgtagcccaggaagtt
gcagaacacgcagaaccggtggttgaaccgcaggaagagacggcagatattgaagaagtt
gccgaaactgctgaggttgtggttgctgaacctgaagttgttactcaacctgccgcgcca
gtcgtcgctgaagtcgcagcagaagttgaaacggtagccgcggttgaacctgagatcacc
gttgagcataaccacgctaccgcgccaatgacacgcgctccggcaccggaatatgttccg
gaggcaccacgtcacagtgactggcagcgccctacttttgccttcgaaggtaaaggtgcc
gcaggtggtcatacggcaacgcatcatgcctctgccgctcctgcgcgtccgcaacctgtt
gagtaa

DBGET integrated database retrieval system