KEGG   Escherichia coli KO11FL: KO11_20140Help
Entry
KO11_20140        CDS       T02104                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase cytochrome b556 small membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ekf  Escherichia coli KO11FL
Pathway
ekf00020  Citrate cycle (TCA cycle)
ekf00190  Oxidative phosphorylation
ekf00650  Butanoate metabolism
ekf01100  Metabolic pathways
ekf01110  Biosynthesis of secondary metabolites
ekf01120  Microbial metabolism in diverse environments
ekf01130  Biosynthesis of antibiotics
ekf01200  Carbon metabolism
Module
ekf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ekf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ekf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ekf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KO11_20140 (sdhD)
   00650 Butanoate metabolism
    KO11_20140 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    KO11_20140 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AFH18994
Structure
PDB: 

Jmol
Position
complement(4261256..4261603)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgccaccagt
ggcgaactgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgattcatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggcattgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system